DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psf1 and psf-1

DIOPT Version :9

Sequence 1:NP_612086.1 Gene:Psf1 / 38136 FlyBaseID:FBgn0035194 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_496153.2 Gene:psf-1 / 187885 WormBaseID:WBGene00011275 Length:201 Species:Caenorhabditis elegans


Alignment Length:191 Identity:74/191 - (38%)
Similarity:119/191 - (62%) Gaps:8/191 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EKAFDLLKELERSSQTIPAFDDDGVRQVLEEIKAIFEENVAQASSYNAS--GDRSLWPLLNFRHA 72
            :||..|:.|::|:...:|.::.:.|||..::|..:|::|.|......|.  .|.:   ||..|.|
 Worm    13 DKALQLVLEMKRNPDVLPPYNTELVRQCYQKIDELFQKNAAVVEKIRAGLPHDST---LLQPRLA 74

  Fly    73 ALQRNKRCLLAYLYERCRRIKALRWEFGPIIPGDIKQALCEPEVTFFNNYSKSLAAYMCSAGYNQ 137
            |:...:||::||:.||..||::.||::|..:|..::.|||:.|:.|||.||.:||.:..:.|  :
 Worm    75 AMCHIRRCMMAYVNERKNRIRSFRWKYGGALPASVRNALCDAEIQFFNEYSSTLARFQSNLG--E 137

  Fly   138 GLPIDLTNNLRPPKSLYIEVRCMEDYGKFELDDGEVIHLKKNSQHYLPRAQVESLVRQGIL 198
            | .::|..:..|||||:::||.:||||:||..||..:.|.|:|.|.|||...|.|:|||:|
 Worm   138 G-GVNLLLHSAPPKSLFVQVRALEDYGEFETSDGTQVQLSKDSLHSLPRQDCEMLIRQGVL 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Psf1NP_612086.1 GINS_A_psf1 9..134 CDD:212548 43/125 (34%)
GINS_B 153..201 CDD:425409 24/46 (52%)
psf-1NP_496153.2 GINS_A_psf1 12..137 CDD:212548 44/128 (34%)
COG5230 18..200 CDD:227555 72/186 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167415
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5230
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H44516
Inparanoid 1 1.050 145 1.000 Inparanoid score I3026
Isobase 1 0.950 - 0 Normalized mean entropy S4395
OMA 1 1.010 - - QHG54100
OrthoDB 1 1.010 - - D1249159at2759
OrthoFinder 1 1.000 - - FOG0003503
OrthoInspector 1 1.000 - - oto19907
orthoMCL 1 0.900 - - OOG6_103148
Panther 1 1.100 - - LDO PTHR12914
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1017
SonicParanoid 1 1.000 - - X3957
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.790

Return to query results.
Submit another query.