DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psf1 and osm-3

DIOPT Version :9

Sequence 1:NP_612086.1 Gene:Psf1 / 38136 FlyBaseID:FBgn0035194 Length:202 Species:Drosophila melanogaster
Sequence 2:NP_001367796.1 Gene:osm-3 / 177141 WormBaseID:WBGene00003884 Length:699 Species:Caenorhabditis elegans


Alignment Length:128 Identity:28/128 - (21%)
Similarity:50/128 - (39%) Gaps:35/128 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EKAFDLLKELERSSQTIPA----FDDDGVRQV-------LEEIKAIFEENVAQASSYNASGDRSL 63
            :|....|||.|..:|.:.|    ..||.:.||       |:.:.:..|:.|.::..|    :|.:
 Worm   455 QKRMKQLKEAETKTQKLAAALNVHKDDPLLQVYSTTQEKLDAVTSQLEKEVKKSKGY----EREI 515

  Fly    64 WPLLNFRHAALQRNKRCLLAYLYERCRRIKALRW---EFGPIIPGDIKQALCEPEVTFFNNYS 123
            ..|    |...:.::...|..:.::.:::|.|..   :..|||..|             .|||
 Worm   516 EDL----HGEFELDRLDYLDTIRKQDQQLKLLMQIMDKIQPIIKKD-------------TNYS 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Psf1NP_612086.1 GINS_A_psf1 9..134 CDD:212548 28/128 (22%)
GINS_B 153..201 CDD:425409
osm-3NP_001367796.1 Motor_domain 3..327 CDD:419868
SMC_prok_B <342..559 CDD:274008 25/124 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.