DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp61F and sub

DIOPT Version :9

Sequence 1:NP_476818.1 Gene:Klp61F / 38135 FlyBaseID:FBgn0004378 Length:1066 Species:Drosophila melanogaster
Sequence 2:NP_001286548.1 Gene:sub / 44870 FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster


Alignment Length:600 Identity:167/600 - (27%)
Similarity:264/600 - (44%) Gaps:163/600 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 QVYVRVRPLNSRERCIRSAEVVDVVGPREVVTRHTLDS------KLTKKFTFDRSFGPESKQCDV 79
            ||::|:||:....:....:|..:|     ::|...:||      ::.|.|.|...|.....|.|:
  Fly    89 QVFLRLRPVKDASKAYIVSEEANV-----LITSCKVDSTSNNVNRMEKHFGFTSIFDSTVGQRDI 148

  Fly    80 YSVVVSPLIEEVLNGYNC-TVFAYGQTGTGKTHTMVGNETAELKSSWEDDSDIGIIPRAL----- 138
            |...|.|.|.|    ..| |:..||.:|:|||:|::|           ||...|||||||     
  Fly   149 YDTCVGPKIME----EECVTIMTYGTSGSGKTYTLLG-----------DDVRAGIIPRALENIFT 198

  Fly   139 ---------------------------------------------------------SHLFDELR 146
                                                                     .|:|:...
  Fly   199 IYQDTVFRSPKLKLINGSIVFLQDDASLKELQIRKKLLDLCPDISAHHQRLKQVIDGDHMFETKA 263

  Fly   147 MMEVEYTMRISYLELYNEELCDLLSTD---------DTTKIRIFDDSTKKGSVIIQGLEEIPVHS 202
            ..:|...:.:|::|:|||.:.|||:..         ....::|..:   ||.|.|:||..:.|.|
  Fly   264 STDVSVLVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKNLKIVGN---KGHVFIKGLTSVFVTS 325

  Fly   203 KDDVYKLLEKGKERRKTATTLMNAQSSRSHTVFSI-VVHIRENGIEGEDMLKIGKLNLVDLAGSE 266
            .::..:||..|::|...|:|.:||.|||||.||:: ::....:||..:...|     ..||||||
  Fly   326 SEEALRLLRLGQQRSTYASTSVNANSSRSHCVFTVDILKYNRSGITTQSSYK-----FCDLAGSE 385

  Fly   267 NVSKAGNEKGIRVRETVNINQSLLTLGRVITAL-----VDRAPHVPYRESKLTRLLQESLGGRTK 326
            .|:..|. .|:|::|..|||.||:.|||.:.|.     ...|..:|||:||||.|||.:|.|:.|
  Fly   386 RVNNTGT-SGLRLKEAKNINTSLMVLGRCLDAASTVQKKKNADIIPYRDSKLTMLLQAALLGKEK 449

  Fly   327 TSIIATISPGHKDIEETLSTLEYAHRAKNIQNKPEVNQKLTKKTVLKEYT------EEIDKLKRD 385
            .::|.|::|..|..||.|:.|.:|..||||         :.|:.|:|::.      .|..|:.  
  Fly   450 LAMIVTVTPLDKYYEENLNVLNFASIAKNI---------IFKEPVIKQHRVSYCGFMEFSKMS-- 503

  Fly   386 LMAARDKNGIYLAEETYGEITLKLESQNRELNEKMLLLK---ALKDELQNKEKIFSEVSMSLVEK 447
                       ..|.  |:.|.:||.:|..|..::..||   .|:.:|. :||:..|::.:..|.
  Fly   504 -----------TCEG--GDYTKELEDENVRLQLEIEQLKYDHVLQMQLL-EEKLRRELTATYQEI 554

  Fly   448 TQELKKTEENLLNTKGTLLLTKK----VLTKTKRRYKEKKELVASHMKTE-QVLTTQAQEILAAA 507
            .|..||..|:....|  ||:.::    :|:..:|||:|:.|    .:|.| :.|...|.:    .
  Fly   555 IQNNKKQYEDECEKK--LLIAQRESEFMLSSQRRRYEEQIE----DLKDEIEELKNPASD----T 609

  Fly   508 DLATDDTHQLHGTIE 522
            |: :||.::....||
  Fly   610 DI-SDDPNESKSPIE 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp61FNP_476818.1 KISc_BimC_Eg5 17..365 CDD:276815 125/427 (29%)
Kinesin 25..356 CDD:278646 121/414 (29%)
Microtub_bind 923..>1009 CDD:290642
subNP_001286548.1 KISc 89..477 CDD:276812 121/416 (29%)
Kinesin 93..479 CDD:278646 121/414 (29%)
GBP_C <512..603 CDD:303769 27/97 (28%)
coiled coil 576..586 CDD:293879 1/9 (11%)
coiled coil 592..603 CDD:293879 3/14 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437844
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.