DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp61F and nod

DIOPT Version :9

Sequence 1:NP_476818.1 Gene:Klp61F / 38135 FlyBaseID:FBgn0004378 Length:1066 Species:Drosophila melanogaster
Sequence 2:NP_001285129.1 Gene:nod / 32107 FlyBaseID:FBgn0002948 Length:666 Species:Drosophila melanogaster


Alignment Length:740 Identity:174/740 - (23%)
Similarity:300/740 - (40%) Gaps:172/740 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 KFTFDRSFGPESKQCDVYSVVVSPLIEEVLNGYNCTVFAYGQTGTGKTHTMVGNETAELKSSWED 127
            :|.||.:|.....|.::|..::.||::::|.|:.||..|||||||||:::|......|:.     
  Fly    47 EFHFDHAFPATISQDEMYQALILPLVDKLLEGFQCTALAYGQTGTGKSYSMGMTPPGEIL----- 106

  Fly   128 DSDIGIIPRALSHLFDELRMMEVEYTMRI----SYLELYNEELCDLLSTDDTTKIRIFDDSTKKG 188
            ...:||:||||..:|:.:...:......|    |::|:|||:..|||.            ||...
  Fly   107 PEHLGILPRALGDIFERVTARQENNKDAIQVYASFIEIYNEKPFDLLG------------STPHM 159

  Fly   189 SVIIQGLEE---IPVHSKDDVYKLLEKGKERRKTATTLMNAQSSRSHTVFSIVVHIRENGIEGED 250
            .::....:.   :|:||:.|::.:||.|...|:...|.||:.|||||.:  :.:|::..      
  Fly   160 PMVAARCQRCTCLPLHSQADLHHILELGTRNRRVRPTNMNSNSSRSHAI--VTIHVKSK------ 216

  Fly   251 MLKIGKLNLVDLAGSENVSKAGNEKGIRVRETVNINQSLLTLGRVITALVDRAPHVPYRESKLTR 315
             ....::|:|||||||.|.:.|:| |:..:|.||||..||::.:|:.::......:|||:|.||.
  Fly   217 -THHSRMNIVDLAGSEGVRRTGHE-GVARQEGVNINLGLLSINKVVMSMAAGHTVIPYRDSVLTT 279

  Fly   316 LLQESLGGRTKTSIIATISPGHKDIEETLSTLEYAHRAKNIQNKPEVNQKLTKKTVLKEYTEEID 380
            :||.||..::..:.:|.|||...|:.||||||.:...||.::..|                    
  Fly   280 VLQASLTAQSYLTFLACISPHQCDLSETLSTLRFGTSAKKLRLNP-------------------- 324

  Fly   381 KLKRDLMAARDKNGIYLAEETYGEITLKLESQNRELNEKMLLLKALKDELQNKEKIFSEVSMSLV 445
                 :..||.|..  ||..|           .....:.:....|:|....|...|.  |..|..
  Fly   325 -----MQVARQKQS--LAART-----------THVFRQALCTSTAIKSNAANHNSIV--VPKSKY 369

  Fly   446 EKTQELKKTEENLLNTKGTLLLTKKVLTKTKRRYKEKKELVASHMKTEQV-LTTQAQEILAAADL 509
            ..|:.|...   |..|:..|.:|    .|.|:|.:|..||..:.::...: :...:..:|.    
  Fly   370 STTKPLSAV---LHRTRSELGMT----PKAKKRARELLELEETTLELSSIHIQDSSLSLLG---- 423

  Fly   510 ATDDTHQLHGTIERRREL-----DEKIRRSCDQFKDRMQDNLEMIGGSLNLYQDQQAALKEQLSQ 569
                   .|...::.|.|     .::.|::..|       |..::|    :.::.:.....::.|
  Fly   424 -------FHSDSDKDRHLMPPPTGQEPRQASSQ-------NSTLMG----IVEETEPKESSKVQQ 470

  Fly   570 EMV-------------NSSYVSQRLALNSSK----SIEMLKEMCAQSLQDQTNLHNKLIGEVMKI 617
            .||             |::.....|..:||:    .|:.::|....|.|...     |...|...
  Fly   471 SMVAPTVPTTVRCQLFNTTISPISLRASSSQRELSGIQPMEETVVASPQQPC-----LRRSVRLA 530

  Fly   618 SDQHSQAF--VAKLMEQMQQQQLLMSKEIQTNLQVIEENNQRHKAMLDSMQEKFATIIDSSLQSV 680
            |...||.:  :.|:|                        |.|....|..::|...:::..:....
  Fly   531 SSMRSQNYGAIPKVM------------------------NLRRSTRLAGIREHATSVVVKNETDA 571

  Fly   681 EEHAKQMHKKLEQLGAMSLPDAEELQNLQEELANERALAQQEDALLESMMMQMEQIKNLRSKNSI 745
            ..|.:...:|.........|.|....|.:..|          |.|....:.|:::|..:..|::.
  Fly   572 IPHLRSTVQKKRTRNVKPAPKAWMANNTKCFL----------DLLNNGNVKQLQEIPGIGPKSAF 626

  Fly   746 SMSVHLNKMEESRLTRNHRIDDIKS 770
            |:::|     .|||.....:..:||
  Fly   627 SLALH-----RSRLGCFENLFQVKS 646

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp61FNP_476818.1 KISc_BimC_Eg5 17..365 CDD:276815 102/308 (33%)
Kinesin 25..356 CDD:278646 101/299 (34%)
Microtub_bind 923..>1009 CDD:290642
nodNP_001285129.1 KISc 8..325 CDD:214526 102/329 (31%)
KISc 8..318 CDD:276812 99/297 (33%)
ComEA 540..648 CDD:224472 24/146 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468181
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.