DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp61F and Kif7

DIOPT Version :10

Sequence 1:NP_476818.1 Gene:Klp61F / 38135 FlyBaseID:FBgn0004378 Length:1066 Species:Drosophila melanogaster
Sequence 2:NP_001278151.1 Gene:Kif7 / 16576 MGIID:1098239 Length:1348 Species:Mus musculus


Alignment Length:30 Identity:9/30 - (30%)
Similarity:16/30 - (53%) Gaps:3/30 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 IQVNKENKEFK---CKRKTIKTKLGGFLWE 104
            :::.:|.:|.|   .|...|:..|..||:|
Mouse   154 VRLQREAEEMKKRLYKLSKIEKGLQVFLFE 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp61FNP_476818.1 KISc_BimC_Eg5 17..365 CDD:276815 9/30 (30%)
SMC_prok_B <408..728 CDD:274008
SMC_prok_B <651..>921 CDD:274008
Microtub_bind 923..>1004 CDD:464048
Kif7NP_001278151.1 KISc_KIF4 15..350 CDD:276823 9/30 (30%)
Interaction with SMO. /evidence=ECO:0000269|PubMed:25644602 358..1211
Interaction with DLG5. /evidence=ECO:0000269|PubMed:25644602 358..479
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 451..486
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 607..674
Smc <707..>1203 CDD:440809
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1288..1314
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1328..1348
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.