DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and TOK1

DIOPT Version :9

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_012442.1 Gene:TOK1 / 853352 SGDID:S000003629 Length:691 Species:Saccharomyces cerevisiae


Alignment Length:135 Identity:35/135 - (25%)
Similarity:62/135 - (45%) Gaps:34/135 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   621 IWLCVFLVVSYILGGAVLFAYWENWSFLDSAYFCFITLTTIGFGDFVPAKGVKDESEQSIAYCSL 685
            :.:.:|:  ::.|.||::|.:.||||:.:..||||:.|.|||:||:.|..|.      ..|:..:
Yeast   384 VTIAIFM--AFWLLGALVFKFAENWSYFNCIYFCFLCLLTIGYGDYAPRTGA------GRAFFVI 440

  Fly   686 YLLFGIALLA--------MSFNL-------VQEEFIANVKEVA-----RRL------GILKDDDD 724
            :.|..:.|:.        :.|::       :.|.|...||.:.     |.|      |.:.::.|
Yeast   441 WALGAVPLMGAILSTVGDLLFDISTSLDIKIGESFNNKVKSIVFNGRQRALSFMVNTGEIFEESD 505

  Fly   725 EQDED 729
            ..|.|
Yeast   506 TADGD 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 <134..189 CDD:285168
NESP55 341..586 CDD:115071
Ion_trans <621..709 CDD:278921 27/102 (26%)
Ion_trans_2 626..706 CDD:285168 26/94 (28%)
TOK1NP_012442.1 Ion_trans_2 253..328 CDD:400301
Ion_trans_2 388..462 CDD:400301 24/81 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I2685
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2198
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.