DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and KCNK16

DIOPT Version :9

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001128577.1 Gene:KCNK16 / 83795 HGNCID:14464 Length:322 Species:Homo sapiens


Alignment Length:206 Identity:57/206 - (27%)
Similarity:92/206 - (44%) Gaps:44/206 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PQRGRCVAAICFSWKVLTCIVSHVLLVLLVVSYCVGGAYLFQHLERPHELEVKRDIQNLRVNLTE 83
            |..|.|   .|:..:||..::::|..:||       ||.:||.|||..|.:.:...|..::...|
Human     2 PSAGLC---SCWGGRVLPLLLAYVCYLLL-------GATIFQLLERQAEAQSRDQFQLEKLRFLE 56

  Fly    84 NI-----WLLSDDAVVLRESDWMANVSKHLANFEKQILTAIKADGWDGDEDLRKSQWTFAGSLFY 143
            |.     |.:.....|:.|: |:..|:..                   ......|.|.|..|.|:
Human    57 NYTCLDQWAMEQFVQVIMEA-WVKGVNPK-------------------GNSTNPSNWDFGSSFFF 101

  Fly   144 SIIVITTIGYGHISPRTDWGKVTTIFYAIVGIPLMLICLSNIGDVMATSFRFLYWRICCYVCTRT 208
            :..|:||||||:::|.|:.|:|..:|||::||||.:|.|:::|..:         |.......|.
Human   102 AGTVVTTIGYGNLAPSTEAGQVFCVFYALLGIPLNVIFLNHLGTGL---------RAHLAAIERW 157

  Fly   209 AKRPRNARSRQ 219
            ..|||.::..|
Human   158 EDRPRRSQVLQ 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 <134..189 CDD:285168 25/54 (46%)
NESP55 341..586 CDD:115071
Ion_trans <621..709 CDD:278921
Ion_trans_2 626..706 CDD:285168
KCNK16NP_001128577.1 Ion_trans_2 <92..148 CDD:311712 25/64 (39%)
Ion_trans_2 180..>224 CDD:311712
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9913
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 121 1.000 Inparanoid score I4753
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.