Sequence 1: | NP_612084.1 | Gene: | galene / 38133 | FlyBaseID: | FBgn0035192 | Length: | 729 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001128577.1 | Gene: | KCNK16 / 83795 | HGNCID: | 14464 | Length: | 322 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 57/206 - (27%) |
---|---|---|---|
Similarity: | 92/206 - (44%) | Gaps: | 44/206 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 PQRGRCVAAICFSWKVLTCIVSHVLLVLLVVSYCVGGAYLFQHLERPHELEVKRDIQNLRVNLTE 83
Fly 84 NI-----WLLSDDAVVLRESDWMANVSKHLANFEKQILTAIKADGWDGDEDLRKSQWTFAGSLFY 143
Fly 144 SIIVITTIGYGHISPRTDWGKVTTIFYAIVGIPLMLICLSNIGDVMATSFRFLYWRICCYVCTRT 208
Fly 209 AKRPRNARSRQ 219 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
galene | NP_612084.1 | Ion_trans_2 | <134..189 | CDD:285168 | 25/54 (46%) |
NESP55 | 341..586 | CDD:115071 | |||
Ion_trans | <621..709 | CDD:278921 | |||
Ion_trans_2 | 626..706 | CDD:285168 | |||
KCNK16 | NP_001128577.1 | Ion_trans_2 | <92..148 | CDD:311712 | 25/64 (39%) |
Ion_trans_2 | 180..>224 | CDD:311712 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 66 | 1.000 | Domainoid score | I9913 |
eggNOG | 1 | 0.900 | - | - | E1_KOG1418 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 121 | 1.000 | Inparanoid score | I4753 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR11003 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.960 |