DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and TPK4

DIOPT Version :9

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_171752.1 Gene:TPK4 / 837846 AraportID:AT1G02510 Length:284 Species:Arabidopsis thaliana


Alignment Length:272 Identity:51/272 - (18%)
Similarity:79/272 - (29%) Gaps:130/272 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RAQSLPAHMLEPAKPQRGRCVAAICFSWKVLTCIVSHVLLVLLVVSYCVGGAYLFQHLERPHELE 69
            |.:::..|:.|..|         |...||:  |      |....|..|||...||.|        
plant   136 RNRAIRDHIAEDGK---------IRLKWKL--C------LAFCAVGLCVGSGALFLH-------- 175

  Fly    70 VKRDIQNLRVNLTENIWLLSDDAVVLRESDWMANVSKHLANFEKQILTAIKADGWDGDEDLRKSQ 134
                                    |....||:                                 
plant   176 ------------------------VFERLDWL--------------------------------- 183

  Fly   135 WTFAGSLFYSIIVITTIGYGHISPRTDWGKVTTIFYAIVGIPLMLICLSNIGDVMATSFRFLYWR 199
                .|::.|:|.:||:|||..:.:|..|:...:|:         :.||.|  .|||.|.:|   
plant   184 ----DSVYLSVISVTTVGYGDKTFKTVEGRGFAVFW---------LLLSTI--AMATLFLYL--- 230

  Fly   200 ICCYVCTRTAKRPRNARSRQRSMRSQRHARSQPPPSFRRSMKMTQRSGNDSGLGPSMGHAYSDPD 264
                                ..||..|....:.|||....:....|   :||       ..|:.|
plant   231 --------------------AEMRIDRTTVMKLPPSESEFIVFKLR---ESG-------RISEDD 265

  Fly   265 LRTMGRGYDDRE 276
            ::.:.|.:::.|
plant   266 IKQIVREFENLE 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 <134..189 CDD:285168 14/54 (26%)
NESP55 341..586 CDD:115071
Ion_trans <621..709 CDD:278921
Ion_trans_2 626..706 CDD:285168
TPK4NP_171752.1 Ion_trans_2 40..118 CDD:285168
Ion_trans_2 169..233 CDD:285168 25/166 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4317
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.