DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and KCO1

DIOPT Version :9

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_200374.1 Gene:KCO1 / 835657 AraportID:AT5G55630 Length:363 Species:Arabidopsis thaliana


Alignment Length:208 Identity:50/208 - (24%)
Similarity:72/208 - (34%) Gaps:91/208 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   539 DNNYEDYPPERHHSRSREPKRNRRRERAERLPPSPRIMSPMGFPVQRQIRRRPSYDYDDDDSMYG 603
            |...:|:......|.||  ||..||.|:          :|.|                  |.||.
plant    17 DTMAQDFNLNSRTSSSR--KRRLRRSRS----------APRG------------------DCMYN 51

  Fly   604 DE------------YGDYGDLLPKDRPVPIW---------LCVFLVVSYILG----GAVLFAYWE 643
            |:            ...:.||.|..|.|.::         ||.:||...|.|    |.|      
plant    52 DDVKIDEPPPHPSKIPMFSDLNPNLRRVIMFLALYLTIGTLCFYLVRDQISGHKTSGVV------ 110

  Fly   644 NWSFLDSAYFCFITLTTIGFGDFVPAKGVKDESEQSIAYCSLYLLFGI----------------- 691
                 |:.|||.:|:||:|:||.||     :.|...:..|: ::..|:                 
plant   111 -----DALYFCIVTMTTVGYGDLVP-----NSSASRLLACA-FVFSGMVLVGHLLSRAADYLVEK 164

  Fly   692 --ALLAMSFNLVQ 702
              |||..:|:|.|
plant   165 QEALLVRAFHLRQ 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 <134..189 CDD:285168
NESP55 341..586 CDD:115071 12/46 (26%)
Ion_trans <621..709 CDD:278921 29/114 (25%)
Ion_trans_2 626..706 CDD:285168 27/100 (27%)
KCO1NP_200374.1 Ion_trans_2 81..163 CDD:400301 23/98 (23%)
Ion_trans_2 202..277 CDD:400301
FRQ1 <235..353 CDD:227455
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4317
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.