DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and KCO5

DIOPT Version :9

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_192093.1 Gene:KCO5 / 828091 AraportID:AT4G01840 Length:408 Species:Arabidopsis thaliana


Alignment Length:194 Identity:40/194 - (20%)
Similarity:68/194 - (35%) Gaps:64/194 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   511 HRRDRRGHSQGRYEDYVEESFDEGSLYGDNNYEDYPPERHHSRSREPK---RNRRRERAERLPPS 572
            |.:|.....|...||...:| ||     .|.:.......|.||:....   ::.|.:..|...||
plant    52 HHQDLEQSVQDDKEDQDSDS-DE-----TNRFLSQTRPLHRSRTAPAMVIIKDLRTKPPETKKPS 110

  Fly   573 PRIMSPMGFPVQRQIRRRPSYDYDDDDSMYGDEYGDYGDLLPKDRPVPIWLCVFLVVSYILGGAV 637
                     ||.:.|.|:                                 .:||::.|:..|..
plant   111 ---------PVSKSIIRQ---------------------------------AIFLLIVYLTLGVS 133

  Fly   638 LFAY-------WENWSFLDSAYFCFITLTTIGFGDFVPAKGVKDESEQSIAYCSLYLLFGIALL 694
            ::::       .|....:|:.|||.:|:.|||:||..|.      :..:..:..:::|||...|
plant   134 IYSFNRDHYSGIETHPVVDALYFCIVTMCTIGYGDIAPL------TPWTKIFAVVFVLFGFGFL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 <134..189 CDD:285168
NESP55 341..586 CDD:115071 18/77 (23%)
Ion_trans <621..709 CDD:278921 20/81 (25%)
Ion_trans_2 626..706 CDD:285168 20/76 (26%)
KCO5NP_192093.1 Ion_trans_2 122..204 CDD:285168 20/76 (26%)
Ion_trans_2 254..325 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4317
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.