DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and KCO6

DIOPT Version :9

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_193550.1 Gene:KCO6 / 827541 AraportID:AT4G18160 Length:436 Species:Arabidopsis thaliana


Alignment Length:340 Identity:61/340 - (17%)
Similarity:95/340 - (27%) Gaps:144/340 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   415 DEDVVRKTPIIPNRYALDDFGGNRRQAAPRSQSMPRSAHQRQRQKDRERERSPQPPPQSSYRQQH 479
            |.:|....|:.|:.:.      .|....|.|.|...|:|.....|        ||.|.||     
plant    31 DNEVAIPMPMTPSEFK------ERLIFGPFSCSPRDSSHFIDSMK--------QPSPSSS----- 76

  Fly   480 DRRAGSLGRQSSRYGNHLELPDYDA--------PPPGRDH---RRDRRGHSQGRYEDYVEESFDE 533
                      |:...|    |..|:        |||.:..   ......|.||            
plant    77 ----------STAVNN----PFSDSSTLDPLLPPPPPQPEPWLSDQTSSHCQG------------ 115

  Fly   534 GSLYGDNNYEDYPPERHHSRSREPKRNRRRERAERLPPSPRIMSPMGFPVQRQIRRRPSYDYDDD 598
                             |:..|           .:..|:..:::.:..|::::            
plant   116 -----------------HALHR-----------SKTAPAMAVINDLHHPIRQK------------ 140

  Fly   599 DSMYGDEYGDYGDLLPKDRPVPIWLCVFLVVSYILGGAVLFAYWEN---------WSFLDSAYFC 654
                        |.....|.|.......|||...||   :..||.|         ...:|..|||
plant   141 ------------DPTETSRSVVRQAFALLVVYLSLG---VLIYWLNRDHYVVNQTHPVVDGLYFC 190

  Fly   655 FITLTTIGFGDFVPAKGVKDESEQSIAYCSLYLLFGIALLAMSFNLV------QEEFIANVKEVA 713
            .:|:.|||:||..|...|..             ||.|..:.:.|..:      ...::.:::|  
plant   191 IVTMCTIGYGDITPNSVVTK-------------LFSIMFVLVGFGFIDILLSGMVSYVLDLQE-- 240

  Fly   714 RRLGILKDDDDEQDE 728
               ..:.|....:||
plant   241 ---SYMLDSAKRRDE 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 <134..189 CDD:285168
NESP55 341..586 CDD:115071 30/181 (17%)
Ion_trans <621..709 CDD:278921 24/102 (24%)
Ion_trans_2 626..706 CDD:285168 24/94 (26%)
KCO6NP_193550.1 Ion_trans_2 156..237 CDD:400301 24/96 (25%)
Ion_trans_2 280..351 CDD:400301
EF-hand_7 374..431 CDD:404394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4317
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.