DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and Kcnk10

DIOPT Version :9

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001303594.1 Gene:Kcnk10 / 72258 MGIID:1919508 Length:538 Species:Mus musculus


Alignment Length:170 Identity:52/170 - (30%)
Similarity:79/170 - (46%) Gaps:36/170 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 WKVLTCIVSHVLLVLLVVSYCVGGAYLFQHLERPHELEVKRDIQNLRVNLTENIWLLSDDAVVLR 96
            ||.:      |.:.::||.|.|.|..:|:.||:|.|...|                   :.:.|.
Mouse    69 WKTV------VAIFVVVVVYLVTGGLVFRALEQPFESSQK-------------------NTIALE 108

  Fly    97 ESDWMANVSKHLA----NFEKQILTAIKADGWD----GDEDLRKSQWTFAGSLFYSIIVITTIGY 153
            :::::.:   |:.    ..|..|..|:.||...    |:.....|.|....:.|::..|||||||
Mouse   109 KAEFLRD---HICVSPQELETLIQHALDADNAGVSPVGNSSNSSSHWDLGSAFFFAGTVITTIGY 170

  Fly   154 GHISPRTDWGKVTTIFYAIVGIPLMLICLSNIGDVMATSF 193
            |:|:|.|:.||:..|.|||.||||....|:.|||.:.|.|
Mouse   171 GNIAPSTEGGKIFCILYAIFGIPLFGFLLAGIGDQLGTIF 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 <134..189 CDD:285168 27/54 (50%)
NESP55 341..586 CDD:115071
Ion_trans <621..709 CDD:278921
Ion_trans_2 626..706 CDD:285168
Kcnk10NP_001303594.1 Ion_trans_2 <152..206 CDD:369572 27/53 (51%)
Ion_trans_2 244..323 CDD:369572
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9871
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.