DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and Kcnk16

DIOPT Version :9

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001102990.1 Gene:Kcnk16 / 688996 RGDID:1582911 Length:292 Species:Rattus norvegicus


Alignment Length:169 Identity:52/169 - (30%)
Similarity:86/169 - (50%) Gaps:27/169 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PQRGRCVAAICFSWKVLTCIVSHVLLVLLVVSYCVGGAYLFQHLERPHELEVKRDIQNLRVNLTE 83
            |:.|.|   .|:..:||..:::::..:||       ||.:||.||:..|.:.:...|..::...|
  Rat     2 PRAGVC---SCWGGQVLPLLLAYICYLLL-------GATIFQRLEKQAEAQSRDQFQLEKLRFLE 56

  Fly    84 NIWLLSDDAVVLRESDWMANVSKHLANFEKQILTA-IKADGWDGDEDLRKSQWTFAGSLFYSIIV 147
            |...|...|               |..|.:.||.| :|.....|: ....|.|.|..|.|::..|
  Rat    57 NYTCLDQQA---------------LEQFVQVILEAWVKGVNPKGN-STNPSNWDFGSSFFFAGTV 105

  Fly   148 ITTIGYGHISPRTDWGKVTTIFYAIVGIPLMLICLSNIG 186
            :||||||:::|.|:.|:|..:|||::||||.::.|:::|
  Rat   106 VTTIGYGNLAPSTEAGQVFCVFYALMGIPLNVVFLNHLG 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 <134..189 CDD:285168 24/53 (45%)
NESP55 341..586 CDD:115071
Ion_trans <621..709 CDD:278921
Ion_trans_2 626..706 CDD:285168
Kcnk16NP_001102990.1 Ion_trans_2 <92..148 CDD:285168 24/53 (45%)
Ion_trans_2 180..248 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9664
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I4566
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.