DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and kcnk1b

DIOPT Version :9

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001277277.1 Gene:kcnk1b / 561206 ZFINID:ZDB-GENE-090312-78 Length:337 Species:Danio rerio


Alignment Length:178 Identity:48/178 - (26%)
Similarity:87/178 - (48%) Gaps:27/178 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SWKVLTCIVSHVLLVLLVVSYCVGGAYLFQHLERPHELEVKRDIQNLRVNLTENIWLLSDDAVVL 95
            :|..|..::.:||       |.:.||.:|..:|.|:|.::::.::.::....:....||::.:  
Zfish    20 AWYFLFLVLGYVL-------YLIFGAVVFSSVELPYEDDLRQQLREIKRLFLQEHQCLSEERL-- 75

  Fly    96 RESDWMANVSKHLANFEKQILTAIKADGWDGDEDLRKSQWTFAGSLFYSIIVITTIGYGHISPRT 160
               :...:.:...:|:...||....| .|:         |.|..|||::..|::|.||||.:|.:
Zfish    76 ---ERFLSKALEASNYGVSILNNASA-SWN---------WDFTSSLFFASTVLSTTGYGHTAPLS 127

  Fly   161 DWGKVTTIFYAIVGIPLMLICLSNIGD-VMATSFRFLYWRICCYVCTR 207
            |.||...|.|:::|||..|:.|:.:.. :|..|    .||...||.||
Zfish   128 DGGKAFCIIYSVIGIPFTLLFLTAVVQRIMVYS----TWRPIMYVHTR 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 <134..189 CDD:285168 22/55 (40%)
NESP55 341..586 CDD:115071
Ion_trans <621..709 CDD:278921
Ion_trans_2 626..706 CDD:285168
kcnk1bNP_001277277.1 Ion_trans_2 <99..157 CDD:285168 23/66 (35%)
Ion_trans_2 192..267 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10296
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.