DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and kcnk2a

DIOPT Version :9

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:XP_021323122.1 Gene:kcnk2a / 559728 ZFINID:ZDB-GENE-061226-2 Length:426 Species:Danio rerio


Alignment Length:182 Identity:61/182 - (33%)
Similarity:91/182 - (50%) Gaps:37/182 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 WKVLTCIVSHVLLVLLVVSYCVGGAYLFQHLERPHELEVKRDIQNLRVNLTENIWLLSDDAVVLR 96
            ||.:..|      .||||.|.:.||.:|:.||:|.|     .:|..|: :.|.|..||....|  
Zfish    57 WKTVLAI------FLLVVLYLIIGATVFKALEQPEE-----GLQKYRI-IQEKIDFLSMHTCV-- 107

  Fly    97 ESDWMANVSKHLANFEKQILTAIKA----DGWDGDEDLRKSQWTFAGSLFYSIIVITTIGYGHIS 157
                  |.|: |.:..||::.||:|    .|...:|   .|.|..:.|.|::..||||||:|::|
Zfish   108 ------NTSE-LEDLVKQVVLAIRAGVNPSGHPSNE---SSMWDLSSSFFFAGTVITTIGFGNVS 162

  Fly   158 PRTDWGKVTTIFYAIVGIPLMLICLSNIGDVMATSF---------RFLYWRI 200
            |.|:.|::..|.||::||||....|:.:||.:.|.|         .|:.|.:
Zfish   163 PHTEGGRIFCIIYALLGIPLFGFLLAGVGDQLGTIFGKGIAKVEKMFVKWNV 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 <134..189 CDD:285168 24/54 (44%)
NESP55 341..586 CDD:115071
Ion_trans <621..709 CDD:278921
Ion_trans_2 626..706 CDD:285168
kcnk2aXP_021323122.1 Ion_trans_2 <140..194 CDD:311712 24/53 (45%)
Ion_trans_2 232..310 CDD:311712
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I9562
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.