DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and kcnk7

DIOPT Version :9

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001373286.1 Gene:kcnk7 / 557297 ZFINID:ZDB-GENE-110304-2 Length:362 Species:Danio rerio


Alignment Length:153 Identity:46/153 - (30%)
Similarity:77/153 - (50%) Gaps:17/153 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KVLTCIVSHVLLVLLVV--SYCVGGAYLFQHLERPHELEVKRDIQNLRVNLTENIWLLSDDAVVL 95
            |.||.:..|..:.|:|.  .:.|.||.:...||:|.|..:.::::.|:..      .|:|:..|.
Zfish     7 KALTFLRVHAFIFLMVAYGLFIVMGAVVLMVLEQPEENLLVQEVRELKAR------FLADNPCVE 65

  Fly    96 RESDWMANVSKHLANFEKQILTAIKADGWDGDEDLRKSQWTFAGSLFYSIIVITTIGYGHISPRT 160
            ..|  :..:...:.:..|:.:.|::|   |.||    ..:.|..|||:.|..:||.|||...|.:
Zfish    66 ERS--LDGLLMDVLSASKRGVAALQA---DSDE----CNFDFTSSLFFVITFLTTTGYGTTVPLS 121

  Fly   161 DWGKVTTIFYAIVGIPLMLICLS 183
            |.|:|..:.|.:|||||.::.||
Zfish   122 DEGRVFCVVYCLVGIPLTMLLLS 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 <134..189 CDD:285168 22/50 (44%)
NESP55 341..586 CDD:115071
Ion_trans <621..709 CDD:278921
Ion_trans_2 626..706 CDD:285168
kcnk7NP_001373286.1 Ion_trans_2 <95..150 CDD:400301 22/50 (44%)
Ion_trans_2 <203..>227 CDD:400301
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I10296
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.