DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and kcnk7

DIOPT Version :10

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001373286.2 Gene:kcnk7 / 557297 ZFINID:ZDB-GENE-110304-2 Length:362 Species:Danio rerio


Alignment Length:153 Identity:46/153 - (30%)
Similarity:77/153 - (50%) Gaps:17/153 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KVLTCIVSHVLLVLLVV--SYCVGGAYLFQHLERPHELEVKRDIQNLRVNLTENIWLLSDDAVVL 95
            |.||.:..|..:.|:|.  .:.|.||.:...||:|.|..:.::::.|:..      .|:|:..|.
Zfish     7 KALTFLRVHAFIFLMVAYGLFIVMGAVVLMVLEQPEENLLVQEVRELKAR------FLADNPCVE 65

  Fly    96 RESDWMANVSKHLANFEKQILTAIKADGWDGDEDLRKSQWTFAGSLFYSIIVITTIGYGHISPRT 160
            ..|  :..:...:.:..|:.:.|::|   |.||    ..:.|..|||:.|..:||.|||...|.:
Zfish    66 ERS--LDGLLMDVLSASKRGVAALQA---DSDE----CNFDFTSSLFFVITFLTTTGYGTTVPLS 121

  Fly   161 DWGKVTTIFYAIVGIPLMLICLS 183
            |.|:|..:.|.:|||||.::.||
Zfish   122 DEGRVFCVVYCLVGIPLTMLLLS 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 115..189 CDD:462301 27/69 (39%)
Ion_trans_2 626..706 CDD:462301
kcnk7NP_001373286.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.