DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and KCNK9

DIOPT Version :9

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:XP_011515403.1 Gene:KCNK9 / 51305 HGNCID:6283 Length:401 Species:Homo sapiens


Alignment Length:168 Identity:58/168 - (34%)
Similarity:82/168 - (48%) Gaps:40/168 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LVLLVVSYCVGGAYLFQHLERPHEL--EVKRDIQNLRVNLTENIWLLSDD-----AVVLRESDWM 101
            |::...:|.:.||.:|..||..||:  |.|...:.:|:....||  .|:|     .|:|:.....
Human    11 LIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNI--SSEDYRQLELVILQSEPHR 73

  Fly   102 ANVSKHLANFEKQILTAIKADGWDGDEDLRKSQWTFAGSLFYSIIVITTIGYGHISPRTDWGKVT 166
            |.|                             ||.||||.:::|.|||||||||.:|.||.||..
Human    74 AGV-----------------------------QWKFAGSFYFAITVITTIGYGHAAPGTDAGKAF 109

  Fly   167 TIFYAIVGIPLMLICLSNIGDVMATSFRFLYWRI--CC 202
            .:|||::||||.|:...::|:.|.|..|:|..||  ||
Human   110 CMFYAVLGIPLTLVMFQSLGERMNTFVRYLLKRIKKCC 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 <134..189 CDD:285168 30/54 (56%)
NESP55 341..586 CDD:115071
Ion_trans <621..709 CDD:278921
Ion_trans_2 626..706 CDD:285168
KCNK9XP_011515403.1 Ion_trans_2 <77..132 CDD:285168 30/54 (56%)
Ion_trans_2 170..243 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2198
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.