DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and kcnk6

DIOPT Version :10

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001025245.2 Gene:kcnk6 / 504083 ZFINID:ZDB-GENE-050309-213 Length:315 Species:Danio rerio


Alignment Length:139 Identity:40/139 - (28%)
Similarity:72/139 - (51%) Gaps:16/139 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VLLVVSYCVGGAYLFQHLERPHELEVKRDIQNLRVNLTENIWLLSDDAVVLRESDWMANVSKHLA 109
            :|...:|.:.||.:|..:|||.|..:|.|:.:|:.... |:..::..|               |.
Zfish    15 ILAYFTYLLLGALVFSAIERPIEESLKADLSSLKAEFL-NLSCVNSTA---------------LE 63

  Fly   110 NFEKQILTAIKADGWDGDEDLRKSQWTFAGSLFYSIIVITTIGYGHISPRTDWGKVTTIFYAIVG 174
            .|.:::|.|.|......:....::.|..|.|||::..::||:||||.:|.:|.||..:|.||::|
Zfish    64 TFLERVLKANKYGVSVLENASLRTNWDLASSLFFANTMVTTVGYGHTTPLSDAGKAFSIVYALIG 128

  Fly   175 IPLMLICLS 183
            :|..::.|:
Zfish   129 VPFTMLVLT 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 115..189 CDD:462301 24/69 (35%)
Ion_trans_2 626..706 CDD:462301
kcnk6NP_001025245.2 Ion_trans_2 <89..144 CDD:462301 21/49 (43%)
Ion_trans_2 178..254 CDD:462301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.