DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and Kcnk7

DIOPT Version :9

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:XP_002728904.1 Gene:Kcnk7 / 499303 RGDID:1565025 Length:316 Species:Rattus norvegicus


Alignment Length:154 Identity:41/154 - (26%)
Similarity:67/154 - (43%) Gaps:32/154 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 W-KVLTCIVSHVLLVLLVVSYCVGGAYLFQHLERPHELEVKRDIQ-NLRVNLTENIWLLSDDAVV 94
            | :.|..:::|:|.:.|       ||.:.|.||.|..|.::..:| .|.....|:...|..:|  
  Rat     7 WARYLLLVMAHLLAMGL-------GAVVLQALEGPPALHLQVQLQAELAAFQAEHRACLPPEA-- 62

  Fly    95 LRESDWMANVSKHLANFEKQILTAIKADG----WDGDEDLRKSQWTFAGSLFYSIIVITTIGYGH 155
                         |......:||| :|.|    .:|.|   .|.|....:|.::..::||.|||.
  Rat    63 -------------LEELLGAVLTA-QAHGVSSLGNGSE---TSNWDLPSALLFTASILTTTGYGR 110

  Fly   156 ISPRTDWGKVTTIFYAIVGIPLML 179
            ::|.:..||...:.||.:|:|..|
  Rat   111 MAPFSSGGKAFCVVYAALGLPASL 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 <134..189 CDD:285168 15/46 (33%)
NESP55 341..586 CDD:115071
Ion_trans <621..709 CDD:278921
Ion_trans_2 626..706 CDD:285168
Kcnk7XP_002728904.1 Ion_trans_2 <88..144 CDD:400301 16/47 (34%)
Ion_trans_2 178..>225 CDD:400301
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I4566
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.950

Return to query results.
Submit another query.