DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and Task7

DIOPT Version :9

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_649891.1 Gene:Task7 / 41125 FlyBaseID:FBgn0037690 Length:340 Species:Drosophila melanogaster


Alignment Length:103 Identity:40/103 - (38%)
Similarity:61/103 - (59%) Gaps:20/103 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   632 ILGGAVLFAYWENWSFLDSAYFCFITLTTIGFGDFVPAKGVKDESEQS-------IAYCSLYLLF 689
            |..||.:|:.:|.||:.||.|:||:|||||||||:|..     :::|:       :|...:::||
  Fly   172 ITTGAAVFSRYEGWSYFDSFYYCFVTLTTIGFGDYVAL-----QNDQALTNKPGYVALSLVFILF 231

  Fly   690 GIALLAMSFNLVQEEFIANVKEVARRLGILKDDDDEQD 727
            |:|::|.|.||:...|:....|.|:|        ||||
  Fly   232 GLAVVAASINLLVLRFMTMQAEDAKR--------DEQD 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 <134..189 CDD:285168
NESP55 341..586 CDD:115071
Ion_trans <621..709 CDD:278921 33/83 (40%)
Ion_trans_2 626..706 CDD:285168 32/80 (40%)
Task7NP_649891.1 Ion_trans_2 <78..133 CDD:285168
Ion_trans_2 166..248 CDD:285168 32/80 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461303
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2198
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.