DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and KCNK2

DIOPT Version :9

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001017425.2 Gene:KCNK2 / 3776 HGNCID:6277 Length:426 Species:Homo sapiens


Alignment Length:238 Identity:70/238 - (29%)
Similarity:102/238 - (42%) Gaps:72/238 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GRRAQSLPAHMLEP------AKPQRGRCVAAICFSWKVLTCIVSHV---------------LLVL 46
            |.||......:|:|      :||:       :.||.|. |.:.|.|               .:.|
Human    11 GYRAGVAAPDLLDPKSAAQNSKPR-------LSFSTKP-TVLASRVESDTTINVMKWKTVSTIFL 67

  Fly    47 LVVSYCVGGAYLFQHLERPHELEVKRDI---------QNLRVNLTENIWLLSDDAVVLRESDWMA 102
            :||.|.:.||.:|:.||:|||:..:..|         |:..||.||                   
Human    68 VVVLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTE------------------- 113

  Fly   103 NVSKHLANFEKQILTAIKADGWD-GDEDLRKSQWTFAGSLFYSIIVITTIGYGHISPRTDWGKVT 166
                 |....:||:.||.|.... |:...:.|.|....|.|::..||||||:|:|||||:.||:.
Human   114 -----LDELIQQIVAAINAGIIPLGNTSNQISHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIF 173

  Fly   167 TIFYAIVGIPLMLICLSNIGDVMATSF---------RFLYWRI 200
            .|.||::||||....|:.:||.:.|.|         .|:.|.:
Human   174 CIIYALLGIPLFGFLLAGVGDQLGTIFGKGIAKVEDTFIKWNV 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 <134..189 CDD:285168 27/54 (50%)
NESP55 341..586 CDD:115071
Ion_trans <621..709 CDD:278921
Ion_trans_2 626..706 CDD:285168
KCNK2NP_001017425.2 Ion_trans_2 <142..196 CDD:400301 27/53 (51%)
Ion_trans_2 234..312 CDD:400301
Required for basal channel activity. /evidence=ECO:0000250 354..426
Essential for chloroform and halothane sensitivity. /evidence=ECO:0000250 378..426
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9913
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.