DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and KCNK1

DIOPT Version :9

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_002236.1 Gene:KCNK1 / 3775 HGNCID:6272 Length:336 Species:Homo sapiens


Alignment Length:185 Identity:53/185 - (28%)
Similarity:86/185 - (46%) Gaps:43/185 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 AAICFSWKVLTCIVSHVLLVLLVVSYCVGGAYLFQHLERPHELEVKRDIQNLRVNLTENIWLLSD 90
            :|.||.:           |||..:.|.|.||.:|..:|.|:|..::::::.|:....|....||:
Human    19 SAWCFGF-----------LVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLKRRFLEEHECLSE 72

  Fly    91 DAV------VLRESDWMANVSKHLANFEKQILTAIKADG-WDGDEDLRKSQWTFAGSLFYSIIVI 148
            ..:      ||..|::..:|   |:|          |.| |:         |.|..:||::..|:
Human    73 QQLEQFLGRVLEASNYGVSV---LSN----------ASGNWN---------WDFTSALFFASTVL 115

  Fly   149 TTIGYGHISPRTDWGKVTTIFYAIVGIPLMLICLSNIGD---VMATSFRFLYWRI 200
            :|.||||..|.:|.||...|.|:::|||..|:.|:.:..   |..|....||:.|
Human   116 STTGYGHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRITVHVTRRPVLYFHI 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 <134..189 CDD:285168 21/57 (37%)
NESP55 341..586 CDD:115071
Ion_trans <621..709 CDD:278921
Ion_trans_2 626..706 CDD:285168
KCNK1NP_002236.1 Ion_trans_2 <101..157 CDD:400301 21/64 (33%)
pore-forming domain 107..123 7/15 (47%)
Ion_trans_2 192..267 CDD:400301
pore-forming domain 212..238
Important for intracellular retention in recycling endosomes. /evidence=ECO:0000269|PubMed:19959478 293..299
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10857
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 121 1.000 Inparanoid score I4753
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.