Sequence 1: | NP_612084.1 | Gene: | galene / 38133 | FlyBaseID: | FBgn0035192 | Length: | 729 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_872137.2 | Gene: | twk-43 / 3565024 | WormBaseID: | WBGene00006693 | Length: | 597 | Species: | Caenorhabditis elegans |
Alignment Length: | 233 | Identity: | 65/233 - (27%) |
---|---|---|---|
Similarity: | 107/233 - (45%) | Gaps: | 65/233 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 44 LVLLVVSYCVGGAYLFQHLER-PHELE----VKRD-----------------IQNLR-------- 78
Fly 79 --------VNLTENIWLLSDDAVVLRESDWMANVSKHLANFEKQILTAIK----ADGWDGDEDLR 131
Fly 132 KSQWTFAGSLFYSIIVITTIGYGHISPRTDWGKVTTIFYAIVGIPLMLICLSNIGDVMATSFR-- 194
Fly 195 ---FLYWRICCYVCTRTAKRPRNA---RSRQRSMRSQR 226 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
galene | NP_612084.1 | Ion_trans_2 | <134..189 | CDD:285168 | 22/54 (41%) |
NESP55 | 341..586 | CDD:115071 | |||
Ion_trans | <621..709 | CDD:278921 | |||
Ion_trans_2 | 626..706 | CDD:285168 | |||
twk-43 | NP_872137.2 | Ion_trans_2 | <162..218 | CDD:285168 | 22/63 (35%) |
Ion_trans_2 | 298..372 | CDD:285168 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR11003 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.010 |