DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and Kcnk9

DIOPT Version :9

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:XP_006520831.1 Gene:Kcnk9 / 223604 MGIID:3521816 Length:604 Species:Mus musculus


Alignment Length:213 Identity:65/213 - (30%)
Similarity:94/213 - (44%) Gaps:51/213 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 HMLEPAKPQRGRCVAA-----------ICFSWKVLTCI----VSHVLLVLLVVSYCVGGAYLFQH 61
            |.|:....:||..|:|           :.||......:    |..:.|:....:|.:.||.:|..
Mouse   166 HRLQLRLHRRGGLVSAALHWDSRGLVQLPFSISFFAAMKRQNVRTLSLIACTFTYLLVGAAVFDA 230

  Fly    62 LERPHELEVKRDIQNLRVNLTENIWLLSDD-----AVVLRESDWMANVSKHLANFEKQILTAIKA 121
            ||..||:..:..::...|.|.....:.|||     .|:|:.....|.|                 
Mouse   231 LESDHEMREEEKLKAEEVRLRGKYNISSDDYQQLELVILQSEPHRAGV----------------- 278

  Fly   122 DGWDGDEDLRKSQWTFAGSLFYSIIVITTIGYGHISPRTDWGKVTTIFYAIVGIPLMLICLSNIG 186
                        ||.||||.:::|.|||||||||.:|.||.||...:|||::||||.|:...::|
Mouse   279 ------------QWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPLTLVMFQSLG 331

  Fly   187 DVMATSFRFLYWRI--CC 202
            :.|.|..|:|..||  ||
Mouse   332 ERMNTFVRYLLKRIKKCC 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 <134..189 CDD:285168 30/54 (56%)
NESP55 341..586 CDD:115071
Ion_trans <621..709 CDD:278921
Ion_trans_2 626..706 CDD:285168
Kcnk9XP_006520831.1 Ion_trans_2 <279..334 CDD:400301 30/54 (56%)
Ion_trans_2 372..445 CDD:400301
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2198
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.