DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and Kcnk13

DIOPT Version :10

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_666149.1 Gene:Kcnk13 / 217826 MGIID:2384976 Length:405 Species:Mus musculus


Alignment Length:137 Identity:41/137 - (29%)
Similarity:71/137 - (51%) Gaps:8/137 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   584 QRQIRRRPSYDYDDDDSMYGDEYGDYGDLLPKDRPVPIWLCVFLVVSYI---LGGAVLFAYWENW 645
            |:|:|||.:.   ..|:|...|.|: .|.|...:|...::.:.|.::.:   .|.:.|:...|.|
Mouse   162 QQQLRRRGAV---TQDNMKAPEKGE-ADSLTGWKPSVYYVMLILCLASVAISCGASALYTTMEGW 222

  Fly   646 SFLDSAYFCFITLTTIGFGDFVPAKGVKDESEQSIAYCSLYL-LFGIALLAMSFNLVQEEFIANV 709
            |:.||.||||:..:||||||.|.::..:.||:....:.:.:| |.|:..:...||::.......|
Mouse   223 SYFDSVYFCFVAFSTIGFGDLVSSQNAQYESQGLYRFFNFFLILMGVCCIYSLFNVISILIKQTV 287

  Fly   710 KEVARRL 716
            ..:.|:|
Mouse   288 NWILRKL 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 115..189 CDD:462301
Ion_trans_2 626..706 CDD:462301 26/83 (31%)
Kcnk13NP_666149.1 Ion_trans_2 84..150 CDD:462301
Selectivity filter 1. /evidence=ECO:0000250|UniProtKB:P57789 110..115
Ion_trans_2 203..285 CDD:462301 25/81 (31%)
Selectivity filter 2. /evidence=ECO:0000250|UniProtKB:P57789 237..242 4/4 (100%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.