DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and twk-25

DIOPT Version :9

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_502170.4 Gene:twk-25 / 192076 WormBaseID:WBGene00006678 Length:683 Species:Caenorhabditis elegans


Alignment Length:174 Identity:47/174 - (27%)
Similarity:81/174 - (46%) Gaps:25/174 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 HVLLVLLVVSYCVGGAYLFQHLERPHELEV----KRDIQNLRVNLTENIWLLSDDAVVLRESDWM 101
            ||.::|||:.|.:.||.||..:|..||.|.    ||.:..:...:.:.:.|...|.:.|..   :
 Worm   289 HVCMLLLVLLYTLLGAALFFSIESRHEHETMHFHKRKLDRIIYEIAQTLELEVLDPMKLTN---I 350

  Fly   102 ANVSKHLANFEKQILTAIKADGWDGD-----EDLRKSQWTFAGSLFYSIIVITTIGYGHISPRTD 161
            ..:...:.....::|.|  .|.:.|.     ||.:..:||:..:.|:|:.|.||.|||.|:|.:.
 Worm   351 TQMEYFITRAYVKLLNA--EDLYSGSTFYKHEDPKNLKWTYGSAFFFSMNVYTTTGYGSIAPSSS 413

  Fly   162 WGKVTTIFYAIVGIPLMLICLSNIGD-----------VMATSFR 194
            .||...|.|.::.:||..:.:.::|.           ::..|||
 Worm   414 LGKALVIVYGLIFVPLTAVVIRDLGQWALLYLTKMYTILIDSFR 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 <134..189 CDD:285168 19/65 (29%)
NESP55 341..586 CDD:115071
Ion_trans <621..709 CDD:278921
Ion_trans_2 626..706 CDD:285168
twk-25NP_502170.4 Ion_trans_2 370..440 CDD:285168 22/69 (32%)
Ion_trans <482..555 CDD:278921
Ion_trans_2 482..551 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.