DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and twk-32

DIOPT Version :9

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_506416.2 Gene:twk-32 / 192075 WormBaseID:WBGene00006684 Length:614 Species:Caenorhabditis elegans


Alignment Length:206 Identity:47/206 - (22%)
Similarity:83/206 - (40%) Gaps:36/206 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VLTCIVSHVLLVLLVVSYCVGGAY---LFQHLERPHELEVKRDIQNLRVNLTENIWLLSD----- 90
            |....:.|:.|:::.:.|.|.|.:   |.::.::.....:..|  ..|.|..:.:.|:.:     
 Worm    29 VFRLALPHITLLVVSILYAVFGGWMLTLIKYSQQTTHQAIMFD--QTRQNFAKRLALIGNKEEFE 91

  Fly    91 ---DAVVLRESDWMANVSKHL---ANFEKQILTAIKADGWDGDEDLRKSQWTFAGSLFYSIIVIT 149
               |.:|.:..|:......|.   |.|....||                  .|..:||::...:|
 Worm    92 SIVDELVEKTYDFYTMEDGHRWQEAAFNANPLT------------------NFTSNLFFAATTLT 138

  Fly   150 TIGYGHISPRTDWGKVTTIFYAIVGIPLMLICLSNIGDVMATSFRFLYWRICCYV--CTRTAKRP 212
            :||||..:|.:..|:|..:.|...||||.||.::::...........|..|..|.  ..|..||.
 Worm   139 SIGYGIDAPESLIGRVFCLVYLFFGIPLYLITIADMAKFCTELMNRTYTEIIKYKYRVKRRYKRW 203

  Fly   213 RNARSRQRSMR 223
            ::.|.|:.||:
 Worm   204 KSGRIRRESMK 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 <134..189 CDD:285168 18/54 (33%)
NESP55 341..586 CDD:115071
Ion_trans <621..709 CDD:278921
Ion_trans_2 626..706 CDD:285168
twk-32NP_506416.2 Ion_trans_2 <125..180 CDD:285168 18/54 (33%)
Ion_trans_2 251..325 CDD:285168
FN3 392..485 CDD:238020
FN3 491..580 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.