Sequence 1: | NP_612084.1 | Gene: | galene / 38133 | FlyBaseID: | FBgn0035192 | Length: | 729 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_506416.2 | Gene: | twk-32 / 192075 | WormBaseID: | WBGene00006684 | Length: | 614 | Species: | Caenorhabditis elegans |
Alignment Length: | 206 | Identity: | 47/206 - (22%) |
---|---|---|---|
Similarity: | 83/206 - (40%) | Gaps: | 36/206 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 VLTCIVSHVLLVLLVVSYCVGGAY---LFQHLERPHELEVKRDIQNLRVNLTENIWLLSD----- 90
Fly 91 ---DAVVLRESDWMANVSKHL---ANFEKQILTAIKADGWDGDEDLRKSQWTFAGSLFYSIIVIT 149
Fly 150 TIGYGHISPRTDWGKVTTIFYAIVGIPLMLICLSNIGDVMATSFRFLYWRICCYV--CTRTAKRP 212
Fly 213 RNARSRQRSMR 223 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
galene | NP_612084.1 | Ion_trans_2 | <134..189 | CDD:285168 | 18/54 (33%) |
NESP55 | 341..586 | CDD:115071 | |||
Ion_trans | <621..709 | CDD:278921 | |||
Ion_trans_2 | 626..706 | CDD:285168 | |||
twk-32 | NP_506416.2 | Ion_trans_2 | <125..180 | CDD:285168 | 18/54 (33%) |
Ion_trans_2 | 251..325 | CDD:285168 | |||
FN3 | 392..485 | CDD:238020 | |||
FN3 | 491..580 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1418 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |