DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and twk-7

DIOPT Version :9

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_498903.3 Gene:twk-7 / 192073 WormBaseID:WBGene00006662 Length:557 Species:Caenorhabditis elegans


Alignment Length:184 Identity:57/184 - (30%)
Similarity:102/184 - (55%) Gaps:32/184 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KVLTCIVSHVLLVLLVVSYCVGGAYLFQHLERPHELEVKRDIQNLRVNLT-ENIWLLSDDAVVL- 95
            |....::.||.||||..:|.|.||.:|..:|:|||..:|.  |.|::..| :|.::  ||.:.| 
 Worm   157 KFAKLVLPHVALVLLTCTYTVIGALIFYSVEQPHEQMMKE--QQLKLIYTRQNEFV--DDLIRLA 217

  Fly    96 -----RESDWMANVSKHLAN--------FEKQILTAIKADGWDGDEDLRKS----QWTFAGSLFY 143
                 :..:|.:...:|:.|        |||..||:         .:::|:    .|||:.|:|:
 Worm   218 AGNETKRYEWESLAERHMHNMSDQLFVAFEKYFLTS---------NEVKKNAATETWTFSSSIFF 273

  Fly   144 SIIVITTIGYGHISPRTDWGKVTTIFYAIVGIPLMLICLSNIGDVMATSFRFLY 197
            ::.|:||||||:..|.|:.|::..|.::::||||.|:.::::|..::....:||
 Worm   274 AVTVVTTIGYGNPVPVTNIGRIWCILFSLLGIPLTLVTIADLGKFLSEHLVWLY 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 <134..189 CDD:285168 22/54 (41%)
NESP55 341..586 CDD:115071
Ion_trans <621..709 CDD:278921
Ion_trans_2 626..706 CDD:285168
twk-7NP_498903.3 Ion_trans_2 <263..321 CDD:285168 22/57 (39%)
Ion_trans <371..>418 CDD:278921
Ion_trans_2 377..>422 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2198
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.