DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and twk-23

DIOPT Version :9

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001257229.1 Gene:twk-23 / 192071 WormBaseID:WBGene00006676 Length:443 Species:Caenorhabditis elegans


Alignment Length:201 Identity:54/201 - (26%)
Similarity:96/201 - (47%) Gaps:22/201 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SW----KVLTCIVSHVLLVLLVVSYCVGGAYLFQHLERPHELEVKRDIQNLRVNLTENIWLLSDD 91
            :|    .||...:.|:.|...||.|...||::|..||..:|.|:....:...:||.:::      
 Worm    31 AWMKFRNVLRIALGHLALYCFVVCYVFAGAWVFHQLEGENETELHDKQREYAMNLKKDV------ 89

  Fly    92 AVVLRESDWMANVSKHLANFEKQILTA-IKADGW---DGDEDLRKSQWTFAGSLFYSIIVITTIG 152
            ...|..::.:|.:::||..|.:.|... |..|.:   :....:...:|||..|:.:|..::||||
 Worm    90 IAKLATTENVAEINEHLRMFLRNISNLHISLDNYLIFNEPTQIVPKRWTFPSSVLFSFTILTTIG 154

  Fly   153 YGHISPRTDWGKVTTIFYAIVGIPLMLICLSNIGDVMATSFRFLYWRICCYVCTRTAKRPRNARS 217
            ||:::|.|...||..:.|...||||.||.::::|....|:...|..::        :||....:|
 Worm   155 YGNVTPHTQQCKVFLMIYGAFGIPLFLITIADLGRFSKTAIMALVQKV--------SKRELKKQS 211

  Fly   218 RQRSMR 223
            .:..:|
 Worm   212 DEHLLR 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 <134..189 CDD:285168 23/54 (43%)
NESP55 341..586 CDD:115071
Ion_trans <621..709 CDD:278921
Ion_trans_2 626..706 CDD:285168
twk-23NP_001257229.1 Ion_trans_2 118..190 CDD:285168 25/71 (35%)
Ion_trans_2 228..302 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.