Sequence 1: | NP_612084.1 | Gene: | galene / 38133 | FlyBaseID: | FBgn0035192 | Length: | 729 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001257229.1 | Gene: | twk-23 / 192071 | WormBaseID: | WBGene00006676 | Length: | 443 | Species: | Caenorhabditis elegans |
Alignment Length: | 201 | Identity: | 54/201 - (26%) |
---|---|---|---|
Similarity: | 96/201 - (47%) | Gaps: | 22/201 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 SW----KVLTCIVSHVLLVLLVVSYCVGGAYLFQHLERPHELEVKRDIQNLRVNLTENIWLLSDD 91
Fly 92 AVVLRESDWMANVSKHLANFEKQILTA-IKADGW---DGDEDLRKSQWTFAGSLFYSIIVITTIG 152
Fly 153 YGHISPRTDWGKVTTIFYAIVGIPLMLICLSNIGDVMATSFRFLYWRICCYVCTRTAKRPRNARS 217
Fly 218 RQRSMR 223 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
galene | NP_612084.1 | Ion_trans_2 | <134..189 | CDD:285168 | 23/54 (43%) |
NESP55 | 341..586 | CDD:115071 | |||
Ion_trans | <621..709 | CDD:278921 | |||
Ion_trans_2 | 626..706 | CDD:285168 | |||
twk-23 | NP_001257229.1 | Ion_trans_2 | 118..190 | CDD:285168 | 25/71 (35%) |
Ion_trans_2 | 228..302 | CDD:285168 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D542195at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR11003 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.020 |