DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and twk-30

DIOPT Version :9

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_492381.3 Gene:twk-30 / 185335 WormBaseID:WBGene00006682 Length:608 Species:Caenorhabditis elegans


Alignment Length:187 Identity:53/187 - (28%)
Similarity:91/187 - (48%) Gaps:41/187 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 HVLLVLLVVSYCVGGAYLFQHLERPHELEVKRD----IQNLRVNLTENIWLLSDDAVVLRESDWM 101
            ||||:..||.|.:.||.:||.||..|...:|:|    |:....:..:.:|     :|..|:.|..
 Worm     8 HVLLIGSVVLYIILGAIVFQMLEGEHLDALKKDHMAKIEQNAKDYVDKLW-----SVAKRDRDKY 67

  Fly   102 ANVSKHLANFEKQILTAIKADGWDG-------------------DEDLRKSQWTFAGSLFYSIIV 147
            .||        :.::.::|.|..|.                   |||  ...|.||.|:|::..:
 Worm    68 KNV--------EDLIKSVKEDTVDDFNDYVDTVFYAHRAVRHGYDED--SPTWDFANSVFFTTTM 122

  Fly   148 ITTIGYGHISPRTDWGKVTTIFYAIVGIPLMLICLSNIGDVMATSFRFLY---WRIC 201
            :|:||||:::|.|..|::..:.|.::||||.|:.::|:...::.:..||:   |..|
 Worm   123 LTSIGYGYVAPSTFGGRLFGVIYCLIGIPLTLVTVANVAKFLSETIFFLHYELWNKC 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 <134..189 CDD:285168 20/54 (37%)
NESP55 341..586 CDD:115071
Ion_trans <621..709 CDD:278921
Ion_trans_2 626..706 CDD:285168
twk-30NP_492381.3 Ion_trans_2 103..166 CDD:285168 23/64 (36%)
Ion_trans_2 224..298 CDD:285168
FN3 379..469 CDD:238020
FN3 475..565 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.