DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and C27F2.6

DIOPT Version :10

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_498055.1 Gene:C27F2.6 / 182966 WormBaseID:WBGene00016168 Length:165 Species:Caenorhabditis elegans


Alignment Length:109 Identity:36/109 - (33%)
Similarity:58/109 - (53%) Gaps:15/109 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   621 IWLCVFLVVSY-ILGGAVLFAYWENWSFLDSAYFCFITLTTIGFGDFVPAKGVKDESEQSIAYCS 684
            |:|...|:.|. :|..:.||:..||.|:..||||.|:|:..|.|||.||.         ::.:.|
 Worm    21 IFLSSLLLCSISLLSSSALFSSIENISYQSSAYFGFMTIFGISFGDIVPT---------NLVWFS 76

  Fly   685 LYLLFGIALLAMSFNLVQEEFIANVKE----VARRLGILKDDDD 724
            .|.||.:....:| |.:...|.|.|:.    :||::.:|:::||
 Worm    77 GYCLFFLISDVLS-NHIFYFFQARVRYFFHILARKILLLREEDD 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 115..189 CDD:462301
Ion_trans_2 626..706 CDD:462301 26/80 (33%)
C27F2.6NP_498055.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.