DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and twk-22

DIOPT Version :9

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001361830.1 Gene:twk-22 / 181703 WormBaseID:WBGene00006675 Length:749 Species:Caenorhabditis elegans


Alignment Length:715 Identity:150/715 - (20%)
Similarity:245/715 - (34%) Gaps:269/715 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FSWKVLTCIVSHVLLVLLVVSY-CVGGAYLFQHLE---RPHELEVKRDIQNLRVNLTENIWLLSD 90
            |.:|:|.  :.::||.|:::.| |:|| |:|..||   :..:|||::     :|.|:|:..|..:
 Worm   167 FLYKLLG--IQYMLLALMILGYACLGG-YIFLTLEYDQQQLDLEVEK-----QVRLSESTLLAEN 223

  Fly    91 DAVVLRESDW---MANVSKHL-----ANFEKQILTA--IKADGWDGDEDLRKSQWTFAGSLFYSI 145
            ....|::  |   .:|.::.|     |..|:.|...  |:.:||         :|.|..|:|:|.
 Worm   224 LLKYLKQ--WNCGQSNENRCLELITKAFIERSIKVERDIRGEGW---------RWDFWNSVFFSA 277

  Fly   146 IVITTIGYGHISPRTDWGKVTTIFYAIVGIPLMLICLSNIGDVMATSFRFLYW--------RICC 202
            .:.||||||:::.:|:.|:|.||.|.::||||||..|...|:      ..:.|        |.|.
 Worm   278 TIFTTIGYGNLACKTNLGRVATIIYGLIGIPLMLFVLKIFGE------HSIKWAQKVRYSIRRCV 336

  Fly   203 YVCTRTAKRPRNARSRQRSMRSQRHARSQPPPSFRRSMKMTQRSGNDSGLGPSMGHAYSDP---- 263
            ..|.|.:|..|                    .|...|:...:....:||:........:.|    
 Worm   337 KRCFRRSKLKR--------------------ASTIESVASDEMPCEESGISEDEEQITTFPVKWA 381

  Fly   264 --------------------------------DLRTMGRG------------------------- 271
                                            .|.|:|.|                         
 Worm   382 LFIVFFFMVVCSLIVSFWEKWDFLTAFYFFFVSLSTIGFGDVIPEHPRTACALFVLYFVGLALFS 446

  Fly   272 -------------------YDDREFGHRSSGGGRNRRQQQQQHLHHDPRQRHTIYGD---GYETQ 314
                               ..|:|:       ..|::|....||     :..||..:   |.|..
 Worm   447 MVYAILQERVENQYMWALELIDQEY-------QENQKQDPDDHL-----EIPTILPENAAGMEGW 499

  Fly   315 TLNRSNRYSSRQRQRDRMRDRHTVERERYSRSHLDAGSIEDFGDMQPPAKRAASVRSVRSPHNQE 379
            | |...:..|:...|.|.::              .|.|:|:..| :|.::|..||.|        
 Worm   500 T-NTIGKMVSQNPVRWRAKN--------------SAYSMENMPD-RPISERRFSVLS-------- 540

  Fly   380 SSKASRELHRLHSAPGRSRAKSVDPRHVSS---HYEDVDEDVVRKTPIIPNRYALDDFGGNRRQA 441
                          ||  .|....|..:.:   |...|.:.::.::..|.||      .|.:|.:
 Worm   541 --------------PG--EAPQAPPPVLGTFMLHSLSVKKKLLARSESILNR------TGTKRPS 583

  Fly   442 A--PRSQSMPRSA---------HQRQRQKDRERERSPQPPPQSSYRQQHDRRAGSLGRQSSRYGN 495
            .  |.::.:..||         |..:..:.:|..|..:|   |:.|........|.|.:|.. |.
 Worm   584 TLFPSNEMLSTSASSSRGSPWPHAAEMNRPKEATRLGEP---SALRVSAPNLTISGGNRSPS-GG 644

  Fly   496 HL----ELPDYDAPPPGRDHRR--------DRRGHSQGRYEDYVEESFDEGSLYGDNNYEDYPPE 548
            .|    |..|.|. ...:.|||        |....:.|..|. :::..||..|...:......|.
 Worm   645 ALSVITEASDEDT-RHFKKHRRPLAKTVSTDGTVSNHGSAES-LDQVMDELQLESHDQAVTPKPY 707

  Fly   549 RHHSRSREPKRNRRRE-----RAERLPPSPRIMSPMGFPVQRQIRRRPSYDYDDDDSMYGDEYGD 608
            |..:.|   .|.|:|:     |||::|.||..:                  .:::|.   ||.||
 Worm   708 RDPTTS---TRFRKRDETVVSRAEKMPLSPNEV------------------LEEEDE---DENGD 748

  Fly   609  608
             Worm   749  748

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 <134..189 CDD:285168 25/54 (46%)
NESP55 341..586 CDD:115071 58/275 (21%)
Ion_trans <621..709 CDD:278921
Ion_trans_2 626..706 CDD:285168
twk-22NP_001361830.1 Ion_trans_2 259..319 CDD:369572 27/68 (40%)
Ion_trans_2 381..457 CDD:369572 4/75 (5%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.