DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and twk-34

DIOPT Version :9

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_506906.3 Gene:twk-34 / 180054 WormBaseID:WBGene00006686 Length:558 Species:Caenorhabditis elegans


Alignment Length:216 Identity:56/216 - (25%)
Similarity:101/216 - (46%) Gaps:36/216 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SLPAHMLEPAKP---QRGRCVAAICFSWKVLTCIVSHVLLVLLVVSYCVGGAYLFQHLERPHE-- 67
            |.|..:.||..|   ...|.:....|..|.:.  :.|:::.|:|:||.:.||::|..:|..:|  
 Worm   132 SSPGALGEPVMPTDRHFDRSMYWFAFHRKQIG--LRHIMVALMVLSYTIFGAFMFWTVESRNERA 194

  Fly    68 --LEVKRDIQN----LRVNLTENIWLLSDDAVVLRESDWMANVSKHLANFEKQILTAIKADG-WD 125
              ||...:::|    |..|:||   ::::......|::....:       .:..::.:|.:| :.
 Worm   195 VTLERVTNLENLLNILATNITE---IVNNPNTTTTEAEMQVYI-------REAYVSLMKLEGQYK 249

  Fly   126 GD-----EDLRKS-QWTFAGSLFYSIIVITTIGYGHISPRTDWGKVTTIFYAIVGIPLMLICLSN 184
            |.     ||..|: :|||..:.|:|:.|.||.|||.|:|.:..|:|....|..:.:|:.|:.|.:
 Worm   250 GSTYYKLEDHGKNWKWTFESAFFFSMNVYTTTGYGSIAPESILGQVLVCLYGFIFVPVTLVALRD 314

  Fly   185 IGDVMATSFRFLY------WR 199
            :|.........||      ||
 Worm   315 LGQFFLVHLTKLYAQLIQRWR 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 <134..189 CDD:285168 20/54 (37%)
NESP55 341..586 CDD:115071
Ion_trans <621..709 CDD:278921
Ion_trans_2 626..706 CDD:285168
twk-34NP_506906.3 Ion_trans_2 250..319 CDD:285168 24/68 (35%)
Ion_trans_2 366..442 CDD:285168
Ion_trans <387..449 CDD:278921
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.