DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and twk-14

DIOPT Version :10

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001367281.1 Gene:twk-14 / 179699 WormBaseID:WBGene00006669 Length:463 Species:Caenorhabditis elegans


Alignment Length:159 Identity:42/159 - (26%)
Similarity:73/159 - (45%) Gaps:25/159 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VLLVLLVVSYCVGGAYLFQHLERPHELEVKRDIQNLRVNLTENIWLLSDDAVVLRESDWMANVSK 106
            ||:.::::.|...||.||..||..:|::.:..|.|                   |.:|:.....|
 Worm    77 VLICIILIVYLAFGAILFHWLEWENEVDERIAIDN-------------------RMADYQKVYCK 122

  Fly   107 HL----ANFEKQILTAIKADGWDGDEDLRKSQWTFAGSLFYSIIVITTIGYGHISPRTDWGKVTT 167
            |.    .:||:.:  ...:||........:|::...||||:|..||:|||:|..:|||..|:..|
 Worm   123 HKPLNECDFEEMV--RFISDGATSGLLNSRSRFDHLGSLFFSATVISTIGFGTSTPRTHLGRFIT 185

  Fly   168 IFYAIVGIPLMLICLSNIGDVMATSFRFL 196
            |.|.:||....::..:...:.:.|...::
 Worm   186 IVYGVVGCTCCVLFFNLFLERLVTGMSYI 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 115..189 CDD:462301 23/73 (32%)
Ion_trans_2 626..706 CDD:462301
twk-14NP_001367281.1 Ion_trans_2 141..208 CDD:462301 22/66 (33%)
Ion_trans_2 272..353 CDD:462301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.