DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and sup-9

DIOPT Version :10

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_494333.1 Gene:sup-9 / 173613 WormBaseID:WBGene00006318 Length:329 Species:Caenorhabditis elegans


Alignment Length:151 Identity:48/151 - (31%)
Similarity:75/151 - (49%) Gaps:30/151 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LVLLVVSYCVGGAYLFQHLERPHELEVKRDIQNLRVNLTENIWLLSDDAVVLRESDWMANVSK-- 106
            |::..::|.:.||.:|..||..:|:..::.:|.:|..|.....:.:.|..:|.     |.:.|  
 Worm    11 LIVCTLTYLLVGAAVFDALETENEILQRKLVQRVREKLKTKYNMSNADYEILE-----ATIVKSV 70

  Fly   107 -HLANFEKQILTAIKADGWDGDEDLRKSQWTFAGSLFYSIIVITTIGYGHISPRTDWGKVTTIFY 170
             |.|.:                      ||.|:|:.:::..|||||||||.:|.||.|||..:.|
 Worm    71 PHKAGY----------------------QWKFSGAFYFATTVITTIGYGHSTPMTDAGKVFCMLY 113

  Fly   171 AIVGIPLMLICLSNIGDVMAT 191
            |:.||||.||...:||:.|.|
 Worm   114 ALAGIPLGLIMFQSIGERMNT 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 115..189 CDD:462301 29/73 (40%)
Ion_trans_2 626..706 CDD:462301
sup-9NP_494333.1 Ion_trans_2 <73..132 CDD:462301 30/80 (38%)
Ion_trans_2 168..242 CDD:462301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.