DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and Kcnk1

DIOPT Version :9

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_032456.2 Gene:Kcnk1 / 16525 MGIID:109322 Length:336 Species:Mus musculus


Alignment Length:185 Identity:53/185 - (28%)
Similarity:86/185 - (46%) Gaps:43/185 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 AAICFSWKVLTCIVSHVLLVLLVVSYCVGGAYLFQHLERPHELEVKRDIQNLRVNLTENIWLLSD 90
            :|.||.:           |||..:.|.|.||.:|..:|.|:|..::::::.|:....|....||:
Mouse    19 SAWCFGF-----------LVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLKRRFLEEHECLSE 72

  Fly    91 DAV------VLRESDWMANVSKHLANFEKQILTAIKADG-WDGDEDLRKSQWTFAGSLFYSIIVI 148
            ..:      ||..|::..:|   |:|          |.| |:         |.|..:||::..|:
Mouse    73 PQLEQFLGRVLEASNYGVSV---LSN----------ASGNWN---------WDFTSALFFASTVL 115

  Fly   149 TTIGYGHISPRTDWGKVTTIFYAIVGIPLMLICLSNIGD---VMATSFRFLYWRI 200
            :|.||||..|.:|.||...|.|:::|||..|:.|:.:..   |..|....||:.|
Mouse   116 STTGYGHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRVTVHVTRRPVLYFHI 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 <134..189 CDD:285168 21/57 (37%)
NESP55 341..586 CDD:115071
Ion_trans <621..709 CDD:278921
Ion_trans_2 626..706 CDD:285168
Kcnk1NP_032456.2 Ion_trans_2 <100..157 CDD:285168 22/65 (34%)
Selectivity filter 1. /evidence=ECO:0000250|UniProtKB:O00180 117..122 3/4 (75%)
Ion_trans_2 191..267 CDD:285168
Selectivity filter 2. /evidence=ECO:0000250|UniProtKB:O00180 225..230
Important for intracellular retention in recycling endosomes. /evidence=ECO:0000250|UniProtKB:O00180 293..299
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 310..336
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 60 1.000 Domainoid score I10523
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 130 1.000 Inparanoid score I4619
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.