DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and KCNK7

DIOPT Version :9

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_203133.1 Gene:KCNK7 / 10089 HGNCID:6282 Length:307 Species:Homo sapiens


Alignment Length:157 Identity:39/157 - (24%)
Similarity:66/157 - (42%) Gaps:39/157 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IVSHVLLVLLVVSYCVGGAYLFQHLERPHELEVKRDIQNLRVNLTENIWLLSDDAVVLRESDWMA 102
            :|:|:|.:.|       ||.:||.||.|....::.:   ||..|.                   |
Human    14 VVAHLLALGL-------GAVVFQALEGPPACRLQAE---LRAELA-------------------A 49

  Fly   103 NVSKHLA-----NFEKQILTAIKADGWDGDEDLRKSQ----WTFAGSLFYSIIVITTIGYGHISP 158
            ..::|.|     ..|:.:.||:.... .|...|..|.    |....:|.::..::||.||||::|
Human    50 FQAEHRACLPPGALEELLGTALATQA-HGVSTLGNSSEGRTWDLPSALLFAASILTTTGYGHMAP 113

  Fly   159 RTDWGKVTTIFYAIVGIPLMLICLSNI 185
            .:..||...:.||.:|:|..|..::.:
Human   114 LSPGGKAFCMVYAALGLPASLALVATL 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 <134..189 CDD:285168 16/56 (29%)
NESP55 341..586 CDD:115071
Ion_trans <621..709 CDD:278921
Ion_trans_2 626..706 CDD:285168
KCNK7NP_203133.1 Ion_trans_2 <90..140 CDD:285168 16/49 (33%)
Ion_trans_2 182..>220 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 121 1.000 Inparanoid score I4753
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.