Sequence 1: | NP_612084.1 | Gene: | galene / 38133 | FlyBaseID: | FBgn0035192 | Length: | 729 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_002933240.1 | Gene: | kcnk10 / 100497885 | XenbaseID: | XB-GENE-950562 | Length: | 545 | Species: | Xenopus tropicalis |
Alignment Length: | 201 | Identity: | 63/201 - (31%) |
---|---|---|---|
Similarity: | 85/201 - (42%) | Gaps: | 43/201 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 HMLEP-AKPQRGRCVAAICFS--------------WKVLTCIVSHVLLVLLVVSYCVGGAYLFQH 61
Fly 62 LERPHELEVKRDIQNLRVNLTENIWLLSDDAVVLRESDWMANVSKHLANFEKQILTAIKADGWD- 125
Fly 126 ---GDEDLRKSQWTFAGSLFYSIIVITTIGYGHISPRTDWGKVTTIFYAIVGIPLMLICLSNIGD 187
Fly 188 VMATSF 193 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
galene | NP_612084.1 | Ion_trans_2 | <134..189 | CDD:285168 | 26/54 (48%) |
NESP55 | 341..586 | CDD:115071 | |||
Ion_trans | <621..709 | CDD:278921 | |||
Ion_trans_2 | 626..706 | CDD:285168 | |||
kcnk10 | XP_002933240.1 | Ion_trans_2 | 158..216 | CDD:285168 | 27/57 (47%) |
Ion_trans_2 | 254..333 | CDD:285168 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | LDO | PTHR11003 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |