DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and kcnk10

DIOPT Version :9

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:XP_002933240.1 Gene:kcnk10 / 100497885 XenbaseID:XB-GENE-950562 Length:545 Species:Xenopus tropicalis


Alignment Length:201 Identity:63/201 - (31%)
Similarity:85/201 - (42%) Gaps:43/201 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 HMLEP-AKPQRGRCVAAICFS--------------WKVLTCIVSHVLLVLLVVSYCVGGAYLFQH 61
            |...| |.|:...|..|...|              ||.:..|      .:|||.|.|.|..:|..
 Frog    44 HQPTPSASPRMSICSRATVVSTIDNTSSGLRSVMKWKTVLAI------FVLVVLYLVTGGLVFGA 102

  Fly    62 LERPHELEVKRDIQNLRVNLTENIWLLSDDAVVLRESDWMANVSKHLANFEKQILTAIKADGWD- 125
            ||:|.|...|..|...:.:     :||:...|..:|.|.:             |..||.||... 
 Frog   103 LEQPFENSQKYIIAQEKAD-----FLLNHPCVTQQELDAL-------------IKRAIDADNAGV 149

  Fly   126 ---GDEDLRKSQWTFAGSLFYSIIVITTIGYGHISPRTDWGKVTTIFYAIVGIPLMLICLSNIGD 187
               |:.....|.|....:.|::..||||||:|:|:|.|:.||:..|.|||.||||....|:.|||
 Frog   150 NPIGNNSNSSSHWDIGSAFFFAGTVITTIGFGNIAPSTEGGKIFCILYAIFGIPLFGFLLAGIGD 214

  Fly   188 VMATSF 193
            .:.|.|
 Frog   215 QLGTIF 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 <134..189 CDD:285168 26/54 (48%)
NESP55 341..586 CDD:115071
Ion_trans <621..709 CDD:278921
Ion_trans_2 626..706 CDD:285168
kcnk10XP_002933240.1 Ion_trans_2 158..216 CDD:285168 27/57 (47%)
Ion_trans_2 254..333 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.