DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and kcnk2

DIOPT Version :9

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:XP_031758740.1 Gene:kcnk2 / 100495685 XenbaseID:XB-GENE-952207 Length:412 Species:Xenopus tropicalis


Alignment Length:183 Identity:63/183 - (34%)
Similarity:92/183 - (50%) Gaps:27/183 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 AKP-----QRGRCVAAICFSWKVLTCIVSHVLLVLLVVSYCVGGAYLFQHLERPHELEVKRDIQN 76
            |||     :..|.:......||.    ||.|.||  ||.|.:.||.:|:.||:|||     ..|.
 Frog    25 AKPAVVSTRDNREITMNVMKWKT----VSTVFLV--VVLYLIIGATVFKALEQPHE-----SAQR 78

  Fly    77 LRVNLTENIWLLSDDAVVLRESDWMANVSKHLANFEKQILTAIKADGWD-GDEDLRKSQWTFAGS 140
            ..:.:.:|.::|:...|.:.|.|.:.          :|::.||.|.... |:...:.|.|....|
 Frog    79 TTIVIQKNNFILNHSCVNVTELDELI----------QQLMAAINAGIIPIGNTSHQNSHWDLGSS 133

  Fly   141 LFYSIIVITTIGYGHISPRTDWGKVTTIFYAIVGIPLMLICLSNIGDVMATSF 193
            .|::..||||||:|:|||||..||:..|.||::||||....|:.:||.:.|.|
 Frog   134 FFFAGTVITTIGFGNISPRTKGGKIFCIIYALLGIPLFGFLLAGVGDQLGTIF 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 <134..189 CDD:285168 27/54 (50%)
NESP55 341..586 CDD:115071
Ion_trans <621..709 CDD:278921
Ion_trans_2 626..706 CDD:285168
kcnk2XP_031758740.1 Ion_trans_2 <128..182 CDD:400301 27/53 (51%)
Ion_trans_2 220..298 CDD:400301
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.