DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment galene and kcnq2a

DIOPT Version :9

Sequence 1:NP_612084.1 Gene:galene / 38133 FlyBaseID:FBgn0035192 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001108379.1 Gene:kcnq2a / 100141342 ZFINID:ZDB-GENE-080220-37 Length:349 Species:Danio rerio


Alignment Length:173 Identity:35/173 - (20%)
Similarity:75/173 - (43%) Gaps:15/173 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RGRCVAAICFSWKVLTCIVSHVLL---VLLVVSYCVGGAYLFQHLERPHELEVKRDIQNLRVNLT 82
            |||    :.|:.|.. ||:..::|   |.::.:...|..:....:.....|::   ::.||::..
Zfish   158 RGR----LRFARKPF-CIIDIMVLFASVSVLAAGSQGNVFATSAIRSLRFLQI---LRMLRMDRR 214

  Fly    83 ENIWLLSDDAVVLRESDWMANVSKHLANFEKQILTAIKADGWDGDEDLRKSQWTFAGSLFYSIIV 147
            ...|.|....|.....:.   ::.....|...||.:......:.|::....: |:|.:|::.::.
Zfish   215 GGTWKLLGSVVYAHSKEL---ITAWYIGFLCLILASFLVYSVEKDDNAEMFE-TYADALWWGLVT 275

  Fly   148 ITTIGYGHISPRTDWGKVTTIFYAIVGIPLMLICLSNIGDVMA 190
            :||||||...|.|..|::....::::|:....:....:|...|
Zfish   276 LTTIGYGDKFPVTWNGRLIAATFSLIGVAFFALPAGILGSGFA 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
galeneNP_612084.1 Ion_trans_2 <134..189 CDD:285168 14/54 (26%)
NESP55 341..586 CDD:115071
Ion_trans <621..709 CDD:278921
Ion_trans_2 626..706 CDD:285168
kcnq2aNP_001108379.1 Ion_trans 119..325 CDD:278921 35/173 (20%)
Ion_trans_2 240..315 CDD:285168 17/75 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.