DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Batf3 and kay

DIOPT Version :9

Sequence 1:NP_084336.1 Gene:Batf3 / 381319 MGIID:1925491 Length:118 Species:Mus musculus
Sequence 2:NP_001027577.2 Gene:kay / 3772082 FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster


Alignment Length:104 Identity:31/104 - (29%)
Similarity:52/104 - (50%) Gaps:16/104 - (15%)


- Green bases have known domain annotations that are detailed below.


Mouse    19 GNQP-----QSPKDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEHESLEQENSVLRREISKLK 78
            |.:|     .:|:::.::..|||:|:.||.|.||::..:.::|.||.|.||:....:|:||..|.
  Fly   404 GRRPNRSTNMTPEEEQKRAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVLT 468

Mouse    79 EELRHLSEVLKEHEKMCPLLLCPMNFVQLRSD--PVASC 115
            .....|..:|..|...|.         ::|||  .|.:|
  Fly   469 NSKNQLEYLLATHRATCQ---------KIRSDMLSVVTC 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Batf3NP_084336.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 18/54 (33%)
bZIP 28..85 CDD:304365 19/56 (34%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 30..55 9/24 (38%)
coiled coil 31..82 CDD:269834 19/50 (38%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 56..84 10/27 (37%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 21/60 (35%)
coiled coil 421..480 CDD:269869 21/58 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.