DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mwh and FMNL3

DIOPT Version :9

Sequence 1:NP_001261244.1 Gene:mwh / 38131 FlyBaseID:FBgn0264272 Length:1069 Species:Drosophila melanogaster
Sequence 2:XP_011537270.1 Gene:FMNL3 / 91010 HGNCID:23698 Length:1047 Species:Homo sapiens


Alignment Length:654 Identity:127/654 - (19%)
Similarity:227/654 - (34%) Gaps:198/654 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 GQLGQLHLEMAPSVCEMAGQGQSGPVP--------PQKASGSNSSKGTNKCGASSLNGSLASYKI 281
            |:..:.||. |..:||    |..|..|        |..:||..||.......|..|.    .|  
Human    24 GKWCRWHLS-ARQLCE----GPKGCGPYILWPSAFPPASSGDRSSMNLPPDKARLLR----QY-- 77

  Fly   282 GGSEQSWPQAPVYSKENQRPPVYN-PEDYVHSLRKFIKASGSAKKLSIYDVFTGPSPKEEASRSA 345
             .:|:.|.    ...:.:|..|.| |..|:..|:.|:..|.:.||..                  
Human    78 -DNEKKWD----LICDQERFQVKNPPHTYIQKLQSFLDPSVTRKKFR------------------ 119

  Fly   346 TLPAKHSEYKSPIPAPPENDREMSLRQFGSITDLLTKLRADLRVSFPSFVQEFVGTPADGISHLL 410
                                     |:....|.:|.:|...||.:...:|:||:.....|:..|:
Human   120 -------------------------RRVQESTKVLRELEISLRTNHIGWVREFLNDENKGLDVLV 159

  Fly   411 EVL-----------------------------RAIQMAQASNA-PAPMPGASSSLAMNRNPQSYQ 445
            :.|                             |:|:..|..:| .||.   ::|||.:......:
Human   160 DYLSFAQCSVMFDFEGLESGDDGAFDKLRSWSRSIEDLQPPSALSAPF---TNSLARSARQSVLR 221

  Fly   446 ------RRALL---------DELSCLQCLSICCSRSLDAIARLGNTPVGLMPLASSATGQGIRAR 495
                  ||||.         |...|:.||....:... ....:.:.|..:..:|.|...:..|.:
Human   222 YSTLPGRRALKNSRLVSQKDDVHVCILCLRAIMNYQY-GFNLVMSHPHAVNEIALSLNNKNPRTK 285

  Fly   496 ILALQLLASACDRQPFGSGSGGQKIASAGHTAVSDAMSTLRLRCSEPVRFRLLVGILNSGGGSGE 560
            .|.|:|||:.|             :...||..:..|....:..|.|..||..|:....:...:.:
Human   286 ALVLELLAAVC-------------LVRGGHEIILAAFDNFKEVCKELHRFEKLMEYFRNEDSNID 337

  Fly   561 LQCAGVKFLNTFIESAVSIQQRLYIQAELFQAGLDASTLARTISSSSPWLDALKIEVKRFNELHI 625
            ...|.::|:|..:.|...:..|:::|.|..:.||: ..|.::..:.|   :.|:::::.:.:...
Human   338 FMVACMQFINIVVHSVEDMNFRVHLQYEFTKLGLE-EFLQKSRHTES---EKLQVQIQAYLDNVF 398

  Fly   626 DVDQMITRARDAERVRSQMVILERRVQILHEEKAVLT----SMERRLQERCAELQREIFRLQGTQ 686
            ||..::   .|||   ::.|.|| :|:.|.|..:.||    .:|.....|.|||::::.:.:...
Human   399 DVGGLL---EDAE---TKNVALE-KVEELEEHVSHLTEKLLDLENENMMRVAELEKQLLQREKEL 456

  Fly   687 QQSKFKPVESSHQPVALPRQVPPPKKNKQNSSEHEDEGISSSETGASLSPVPILILPSKAKPSRK 751
            :..|.....:|||...|                                              |:
Human   457 ESIKETYENTSHQVHTL----------------------------------------------RR 475

  Fly   752 VVEEDED---DAATIEDVIEELDNIVSEAEKQISSQTSSVTRP----KMRHHRPVEKEIVPVNIV 809
            :::|.|:   ....:|..:..|:::.|||..::.....|...|    .:....|..:|::|:...
Human   476 LIKEKEEAFQRRCHLEPNVRGLESVDSEALARVGPAELSEGMPPSDLDLLAPAPPPEEVLPLPPP 540

  Fly   810 PQPP 813
            |.||
Human   541 PAPP 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mwhNP_001261244.1 Drf_GBD <380..506 CDD:283920 36/170 (21%)
Drf_FH3 524..725 CDD:283917 43/204 (21%)
FMNL3XP_011537270.1 Drf_GBD 64..297 CDD:283920 54/303 (18%)
Drf_FH3 300..497 CDD:283917 47/253 (19%)
FH2 580..945 CDD:280362
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1923
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.