DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mwh and Fmnl3

DIOPT Version :9

Sequence 1:NP_001261244.1 Gene:mwh / 38131 FlyBaseID:FBgn0264272 Length:1069 Species:Drosophila melanogaster
Sequence 2:NP_035841.1 Gene:Fmnl3 / 22379 MGIID:109569 Length:1028 Species:Mus musculus


Alignment Length:597 Identity:117/597 - (19%)
Similarity:206/597 - (34%) Gaps:185/597 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 PSVCEMAGQG----QSGPVPPQKASGSNSSKGTNKCGASSLNGSLASYKIGGSEQSWPQAPVYSK 296
            |..||:..:.    .|..:||.||.                  .|..|   .:|:.|.    ...
Mouse    29 PEPCELEERFALVLSSMNLPPDKAR------------------LLRQY---DNEKKWD----LIC 68

  Fly   297 ENQRPPVYN-PEDYVHSLRKFIKASGSAKKLSIYDVFTGPSPKEEASRSATLPAKHSEYKSPIPA 360
            :.:|..|.| |..|:..|:.|:..:.:.||..                                 
Mouse    69 DQERFQVKNPPHTYIQKLQSFLDPNVTRKKFR--------------------------------- 100

  Fly   361 PPENDREMSLRQFGSITDLLTKLRADLRVSFPSFVQEFVGTPADGISHLLEVL------------ 413
                      |:....|.:|.:|...||.:...:|:||:.....|:..|::.|            
Mouse   101 ----------RRVQESTKVLRELEISLRTNHIGWVREFLNDENKGLDVLVDYLSFAQCSVMFDFE 155

  Fly   414 -----------------RAIQMAQASNA-PAPMPGASSSLAMNRNPQSYQ------RRALL---- 450
                             |:|:..|..|| .||.   ::|||.:......:      ||||.    
Mouse   156 GLESGDDGAFDKLRSWSRSIEDLQPPNALSAPF---TNSLARSARQSVLRYSTLPGRRALKNSRL 217

  Fly   451 -----DELSCLQCLSICCSRSLDAIARLGNTPVGLMPLASSATGQGIRARILALQLLASACDRQP 510
                 |...|:.||....:... ....:.:.|..:..:|.|...:..|.:.|.|:|||:.|    
Mouse   218 VSQKDDVHVCILCLRAIMNYQY-GFNLVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVC---- 277

  Fly   511 FGSGSGGQKIASAGHTAVSDAMSTLRLRCSEPVRFRLLVGILNSGGGSGELQCAGVKFLNTFIES 575
                     :...||..:..|....:..|.|..||..|:....:...:.:...|.::|:|..:.|
Mouse   278 ---------LVRGGHEIILAAFDNFKEVCKELHRFEKLMEYFRNEDSNIDFMVACMQFINIVVHS 333

  Fly   576 AVSIQQRLYIQAELFQAGLDASTLARTISSSSPWLDALKIEVKRFNELHIDVDQMITRARDAERV 640
            ...:..|:::|.|..:.||: ..|.::..:.|   :.|:::::.:.:...||..::   .|||  
Mouse   334 VEDMNFRVHLQYEFTKLGLE-EFLQKSRHTES---EKLQVQIQAYLDNVFDVGGLL---EDAE-- 389

  Fly   641 RSQMVILERRVQILHEEKAVLT----SMERRLQERCAELQREIFRLQGTQQQSKFKPVESSHQPV 701
             ::.|.|| :|:.|.|..:.||    .:|.....|.|||::::.:.:...:..|.....:|:|..
Mouse   390 -TKNVALE-KVEELEEHVSHLTEKLLDLENENMMRVAELEKQLLQREKELESIKETYENTSNQVH 452

  Fly   702 ALPRQVPPPKKNKQNSSEHE--------------------------DEGISSSETGASLSPVP-- 738
            .|.|.:    |.|:.:.:..                          .|||..|:... |:|.|  
Mouse   453 TLRRLI----KEKEEAFQRRCHLEPSARGLESMGGEALARVGPTELTEGIPPSDLDL-LAPAPPT 512

  Fly   739 --ILILPSKAKP 748
              .|.||....|
Mouse   513 EETLPLPPPPAP 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mwhNP_001261244.1 Drf_GBD <380..506 CDD:283920 37/170 (22%)
Drf_FH3 524..725 CDD:283917 46/230 (20%)
Fmnl3NP_035841.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
Drf_GBD 26..278 CDD:283920 61/333 (18%)
Drf_FH3 281..472 CDD:283917 45/205 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 493..541 11/33 (33%)
FH2 561..926 CDD:280362
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1923
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.