DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysS and LYZL1

DIOPT Version :10

Sequence 1:NP_476829.1 Gene:LysS / 38130 FlyBaseID:FBgn0004430 Length:140 Species:Drosophila melanogaster
Sequence 2:XP_005252684.1 Gene:LYZL1 / 84569 HGNCID:30502 Length:185 Species:Homo sapiens


Alignment Length:68 Identity:23/68 - (33%)
Similarity:32/68 - (47%) Gaps:4/68 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QANSASGMHVSDECKLKFLELKAKRNYRFIVFKIDEKAQQVMIDKLGNPEETYEDFTRSIPED-- 68
            |..|....|:.||..||.|..||: |....|.|..||.|.| :.:|....|..|...:||.::  
Human   700 QMGSLKEQHLRDEADLKTLLSKAE-NQAKDVQKEYEKTQTV-LSELKLKFEMTEQEKQSITDELK 762

  Fly    69 ECR 71
            :|:
Human   763 QCK 765

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysSNP_476829.1 LYZ_C_invert 20..139 CDD:381618 18/54 (33%)
LYZL1XP_005252684.1 LYZ_C 66..173 CDD:340383
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.