DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysS and LYZL1

DIOPT Version :9

Sequence 1:NP_476829.1 Gene:LysS / 38130 FlyBaseID:FBgn0004430 Length:140 Species:Drosophila melanogaster
Sequence 2:XP_005252684.1 Gene:LYZL1 / 84569 HGNCID:30502 Length:185 Species:Homo sapiens


Alignment Length:129 Identity:46/129 - (35%)
Similarity:69/129 - (53%) Gaps:5/129 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFFALVLLAIAAPALAGRTLDRCSLAREMADLGVPR---DQLDKWTCIAQHESDYRTWVVGPA 62
            |||...|.|:.........:...||.||:..:..|:..   ..|..|.|:|.:||.|.| .....
Human    47 MKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNT-TAQTV 110

  Fly    63 NSDGSNDYGIFQINDLYWCQADGRFSYNECGLSCNALLTDDITNSVRCAQKVLSQ-QGWSAWAV 125
            ..|||.||||||||...||:.......|.|.::|:||:|||:|:::.||:|::.: ||.:.|::
Human   111 LDDGSIDYGIFQINSFAWCRRGKLKENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWSL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysSNP_476829.1 LYZ1 20..140 CDD:197612 41/110 (37%)
LYZL1XP_005252684.1 LYZ1 66..172 CDD:238066 40/106 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153952
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6956
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8437
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.910

Return to query results.
Submit another query.