DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysS and lyz

DIOPT Version :9

Sequence 1:NP_476829.1 Gene:LysS / 38130 FlyBaseID:FBgn0004430 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_631919.1 Gene:lyz / 677744 ZFINID:ZDB-GENE-020515-2 Length:151 Species:Danio rerio


Alignment Length:143 Identity:44/143 - (30%)
Similarity:71/143 - (49%) Gaps:12/143 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ALVLLAIA-APALAGRTLDRCSLAREMADLGVPRDQ---LDKWTCIAQHESDYRTWVVGPANSDG 66
            |:|.|.:| ..:...:||.||.:.:...:.|:...:   :..:.|.|..||.::|..|  .::|.
Zfish     4 AVVFLCLAWMSSCESKTLGRCDVYKIFKNEGLDGFEGFSIGNYVCTAYWESRFKTHRV--RSADT 66

  Fly    67 SNDYGIFQINDLYWCQADGRFSYNECGLSCNALLTDDITNSVRCAQKVLSQQGWSAWAVW-HYCS 130
            ..||||||||...||........|.|.::|:.||.||:..||.||:.::...|..:|..| .||:
Zfish    67 GKDYGIFQINSFKWCDDGTPGGKNLCKVACSDLLNDDLKASVGCAKLIVKMDGLKSWETWDSYCN 131

  Fly   131 G-----WLPSIDE 138
            |     |:...::
Zfish   132 GRKMSRWVKGCEQ 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysSNP_476829.1 LYZ1 20..140 CDD:197612 40/128 (31%)
lyzNP_631919.1 LYZ1 19..140 CDD:238066 40/122 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589125
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.