DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysS and LYZL6

DIOPT Version :9

Sequence 1:NP_476829.1 Gene:LysS / 38130 FlyBaseID:FBgn0004430 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001186880.1 Gene:LYZL6 / 57151 HGNCID:29614 Length:148 Species:Homo sapiens


Alignment Length:122 Identity:44/122 - (36%)
Similarity:65/122 - (53%) Gaps:11/122 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LDRCSLAR--EMADL-GVPRDQLDKWTCIAQHESDYRTWVVGPANSDGSNDYGIFQINDLYWCQA 83
            :.||.||:  ::.|| |.....|..|.|:|..||.:....:. .|:|||.|||:||||..|||..
Human    22 ISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNISKIN-ENADGSFDYGLFQINSHYWCND 85

  Fly    84 DGRFSYNECGLSCNALLTDDITNSVRCAQKVLS-QQGWSAWAVWH-YCSG-----WL 133
            ...:|.|.|.:.|..||..::...:.||::::| .:|.:.|..|. :|||     ||
Human    86 YKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRPLFYWL 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysSNP_476829.1 LYZ1 20..140 CDD:197612 44/122 (36%)
LYZL6NP_001186880.1 LYZ1 22..142 CDD:238066 42/120 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153920
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8437
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.