DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysS and LysP

DIOPT Version :9

Sequence 1:NP_476829.1 Gene:LysS / 38130 FlyBaseID:FBgn0004430 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_476828.1 Gene:LysP / 38129 FlyBaseID:FBgn0004429 Length:141 Species:Drosophila melanogaster


Alignment Length:141 Identity:105/141 - (74%)
Similarity:119/141 - (84%) Gaps:1/141 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFFALVLLAIAAPALAGRTLDRCSLAREMADLGVPRDQLDKWTCIAQHESDYRTWVVGPANSD 65
            ||||..:..|.:.|.|...||:|||||||||:.||||||||.||||||||||.:||.|||||||:
  Fly     1 MKAFLVICALTLTAVATQARTMDRCSLAREMSKLGVPRDQLAKWTCIAQHESSFRTGVVGPANSN 65

  Fly    66 GSNDYGIFQINDLYWCQ-ADGRFSYNECGLSCNALLTDDITNSVRCAQKVLSQQGWSAWAVWHYC 129
            |||||||||||:.|||: ||||||||||||||||||||||||||:||:|:..||||:||:.|.||
  Fly    66 GSNDYGIFQINNKYWCKPADGRFSYNECGLSCNALLTDDITNSVKCARKIQRQQGWTAWSTWKYC 130

  Fly   130 SGWLPSIDECF 140
            ||.||||:.||
  Fly   131 SGSLPSINSCF 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysSNP_476829.1 LYZ1 20..140 CDD:197612 96/120 (80%)
LysPNP_476828.1 LYZ1 20..141 CDD:197612 96/120 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468978
Domainoid 1 1.000 111 1.000 Domainoid score I12139
eggNOG 1 0.900 - - E1_2BPI7
Homologene 1 1.000 - - H80675
Inparanoid 1 1.050 130 1.000 Inparanoid score I7030
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D116778at33392
OrthoFinder 1 1.000 - - FOG0004526
OrthoInspector 1 1.000 - - mtm8677
orthoMCL 1 0.900 - - OOG6_107030
Panther 1 1.100 - - P PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
1312.810

Return to query results.
Submit another query.