DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysS and LysE

DIOPT Version :10

Sequence 1:NP_476829.1 Gene:LysS / 38130 FlyBaseID:FBgn0004430 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_476827.2 Gene:LysE / 38128 FlyBaseID:FBgn0004428 Length:140 Species:Drosophila melanogaster


Alignment Length:141 Identity:115/141 - (81%)
Similarity:124/141 - (87%) Gaps:2/141 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFFALVLLAIAAPALAGRTLDRCSLAREMADLGVPRDQLDKWTCIAQHESDYRTWVVGPANSD 65
            ||||..||.||:||||| |||||||||||||::||||||||.:|.|||:|||.|||.||||.|.:
  Fly     1 MKAFIVLVALAMAAPAL-GRTLDRCSLAREMSNLGVPRDQLARWACIAEHESSYRTGVVGPENYN 64

  Fly    66 GSNDYGIFQINDLYWC-QADGRFSYNECGLSCNALLTDDITNSVRCAQKVLSQQGWSAWAVWHYC 129
            |||||||||||:.||| ...|||||||||||||||||||||:|||||||||||||||||:.||||
  Fly    65 GSNDYGIFQINNYYWCAPPSGRFSYNECGLSCNALLTDDITHSVRCAQKVLSQQGWSAWSTWHYC 129

  Fly   130 SGWLPSIDECF 140
            ||||||||.||
  Fly   130 SGWLPSIDGCF 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysSNP_476829.1 LYZ_C_invert 20..139 CDD:381618 99/119 (83%)
LysENP_476827.2 LYZ_C_invert 19..139 CDD:381618 99/119 (83%)

Return to query results.
Submit another query.