DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysS and LysX

DIOPT Version :10

Sequence 1:NP_476829.1 Gene:LysS / 38130 FlyBaseID:FBgn0004430 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_523881.1 Gene:LysX / 38122 FlyBaseID:FBgn0004431 Length:142 Species:Drosophila melanogaster


Alignment Length:141 Identity:100/141 - (70%)
Similarity:119/141 - (84%) Gaps:1/141 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFFALVLLAIAAPALAGRTLDRCSLAREMADLGVPRDQLDKWTCIAQHESDYRTWVVGPANSD 65
            |:|...:.:||:..||:.|||:||||||||||::||.||||.||.|||:|||.|||.||||.|:|
  Fly     1 MRALLGICVLALVTPAVLGRTMDRCSLAREMANMGVSRDQLSKWACIAEHESSYRTGVVGPPNTD 65

  Fly    66 GSNDYGIFQINDLYWCQ-ADGRFSYNECGLSCNALLTDDITNSVRCAQKVLSQQGWSAWAVWHYC 129
            ||||||||||||:|||| :.|:||:|.|.:||||||||||.:|||||.|||.|||||||:.||||
  Fly    66 GSNDYGIFQINDMYWCQPSSGKFSHNGCDVSCNALLTDDIKSSVRCALKVLGQQGWSAWSTWHYC 130

  Fly   130 SGWLPSIDECF 140
            ||:||.||:||
  Fly   131 SGYLPPIDDCF 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysSNP_476829.1 LYZ_C_invert 20..139 CDD:381618 91/119 (76%)
LysXNP_523881.1 LYZ_C_invert 20..140 CDD:381618 91/119 (76%)

Return to query results.
Submit another query.