DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysS and CG11159

DIOPT Version :9

Sequence 1:NP_476829.1 Gene:LysS / 38130 FlyBaseID:FBgn0004430 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_611505.1 Gene:CG11159 / 37341 FlyBaseID:FBgn0034539 Length:146 Species:Drosophila melanogaster


Alignment Length:144 Identity:46/144 - (31%)
Similarity:67/144 - (46%) Gaps:17/144 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FFALVLLAIAAPALAGRTLDRCSLAREMADLGVPRDQLDKWTCIAQHESDYRTWVVGPANS---- 64
            |..|.||.::......:.|.||.||:|:.....||..|..|.|:.:.||       |.:.|    
  Fly    12 FLVLNLLLLSQWETESKLLTRCQLAKELLRHDFPRSYLSNWVCLVEAES-------GRSTSKSMQ 69

  Fly    65 --DGSNDYGIFQINDLYWCQADGRFSYNECGLSCNALLTDDITNSVRCAQKVLSQQGWSAWAVW- 126
              :.|..||:||||...||:...|...  |.:.|...|.|:|::..|||.::.::.|:.||..| 
  Fly    70 LPNQSVSYGLFQINSKNWCRKGRRGGI--CNIKCEEFLNDEISDDSRCAMQIFNRHGFQAWPGWM 132

  Fly   127 HYCSG-WLPSIDEC 139
            ..|.| .||.:..|
  Fly   133 SKCRGRTLPDVSRC 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysSNP_476829.1 LYZ1 20..140 CDD:197612 42/128 (33%)
CG11159NP_611505.1 LYZ_C_invert 28..146 CDD:381618 41/126 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458899
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D116778at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
76.860

Return to query results.
Submit another query.